ESTScan Details for Unigene SGN-U269294

Score 
936
Direction 
Forward
Predicted Peptide Sequence 
MDDDNKVVVFERGDLVFVFNFHPKNTYEGYKVGCDLPGKYRVALDSDAWEFGGHGRAGHDVDHFTSPEGIPGVPETNFNGRPNSFKVLSP
ARTCVAYYRVDERMSETEDYQTDICSELLPTANIEESDEKLKDSSSTNISTSSTKNAYYRVDERMSEAEDYQTDICSELLPTANIEESDE
KLDDSLSTNISNIGQTVVVSVEERDKELKDSPSVSIISDAVPAEWADSDANVWGEDYQMIDRSFYVGDLGPVHDXLQGGSID
Predicted Coding Sequence 
ATGGATGATGATAATAAGGTTGTTGTGTTTGAACGTGGTGACCTGGTATTTGTATTCAACTTCCACCCAAAGAACACATACGAAGGGTAT
AAAGTTGGATGTGACTTGCCAGGGAAGTACAGAGTTGCACTGGACAGTGATGCTTGGGAATTTGGTGGCCATGGAAGAGCTGGTCATGAT
GTTGACCATTTCACATCACCAGAAGGAATACCTGGAGTTCCAGAAACAAATTTCAATGGTCGTCCAAATTCCTTCAAAGTGCTGTCTCCT
GCGCGAACATGTGTGGCTTATTACAGAGTTGATGAACGCATGTCAGAAACTGAAGATTACCAGACAGACATTTGTAGTGAGCTACTACCA
ACAGCCAATATCGAGGAAAGTGACGAGAAACTTAAAGATTCATCATCTACAAATATCAGTACATCATCTACAAAAAATGCTTATTACAGA
GTTGATGAACGCATGTCAGAAGCTGAAGATTACCAGACAGACATTTGTAGTGAGCTACTACCAACAGCCAATATCGAGGAGAGTGACGAG
AAACTTGATGATTCATTATCTACAAATATCAGTAACATTGGTCAGACTGTTGTAGTTTCTGTTGAGGAGAGAGACAAGGAACTTAAAGAT
TCACCATCTGTAAGCATCATTAGTGATGCTGTTCCAGCTGAATGGGCTGATTCGGATGCAAACGTCTGGGGTGAGGACTATCAGATGATT
GATCGATCCTTCTACGTTGGTGATCTTGGTCCXGTGCATGATGXTCTTCAGGGTGGTAGCATTGACTGA\
Edits in Original Sequence 
AGATAGTAAGCAGC(5')ATGGATGATGATAATAAGGTTGTTGTGTTTGAACGTGGTGACCTGGTATTTGTATTCAACTTCCACCCAAAG
AACACATACGAAGGGTATAAAGTTGGATGTGACTTGCCAGGGAAGTACAGAGTTGCACTGGACAGTGATGCTTGGGAATTTGGTGGCCAT
GGAAGAGCTGGTCATGATGTTGACCATTTCACATCACCAGAAGGAATACCTGGAGTTCCAGAAACAAATTTCAATGGTCGTCCAAATTCC
TTCAAAGTGCTGTCTCCTGCGCGAACATGTGTGGCTTATTACAGAGTTGATGAACGCATGTCAGAAACTGAAGATTACCAGACAGACATT
TGTAGTGAGCTACTACCAACAGCCAATATCGAGGAAAGTGACGAGAAACTTAAAGATTCATCATCTACAAATATCAGTACATCATCTACA
AAAAATGCTTATTACAGAGTTGATGAACGCATGTCAGAAGCTGAAGATTACCAGACAGACATTTGTAGTGAGCTACTACCAACAGCCAAT
ATCGAGGAGAGTGACGAGAAACTTGATGATTCATTATCTACAAATATCAGTAACATTGGTCAGACTGTTGTAGTTTCTGTTGAGGAGAGA
GACAAGGAACTTAAAGATTCACCATCTGTAAGCATCATTAGTGATGCTGTTCCAGCTGAATGGGCTGATTCGGATGCAAACGTCTGGGGT
GAGGACTAgTCAGATGATTGATCGATCCTTCTACGTTGGTGATCTTGGTCCXGTGCATGATGXTCTTCAGGGTGGTAGCATTGACTGA\
(3')TTGCATCATAGTTTTTTTTTTTTTTTTTAAGTATTTCCTCTATGCATATTATTAGCATCCAATAAATTTACTGGTTGTTGTACATAG
AAAAAGTGCATTTGCATGTATGTGTTTCTCTGAAATTTTCCCCAGTTTTTGGTGCTTTGCCTTTGGAGCCAAGTCTCTATATGTAATAAG
AAAACTAAGAACAATCACATATATAAAATGTTAGTAGATTACCATAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan