ESTScan Details for Unigene SGN-U269295

Score 
2141
Direction 
Forward
Predicted Peptide Sequence 
PSVSIISDVVPAEWDDSDANVWGENNKKVKAEAKYHNLINGNNFNVLSKPIRGSFPSFSPKVSSGASRNKICFPSQHSTGLKFGSQERSW
DISSTPKSRVRKDERMKHSSAISAVLTDDNSTMAPLEEDVKTENIGLLNLDPTLEPYLDHFRHRMKRYVDQKMLIEKYEGPLEEFAQGYL
KFGFNREDGCIVYREWAPAAQEAEVIGDFNGWNGSNHMMEKDQFGVWSIRIPDVDSKPVIPHNSRVKFRFKHGNGVWVDRIPAWIKYATA
DATKFAAPYDGVYWDPPPSERYHFKYPRPPKPRAPRIYEAHVGMSSSEPRVNSYREFADDVLPRIKANNYNTVQLMAIMEHSYYGSFGYH
VTNFFAVSNRYGNPEDLKYLIDKAHSLGLQVLVDVVHSHASNNVTDGLNGFDIGQGSQESYFHAGERGYHKLWDSRLFNYANWEVLRFLL
SNLRWWLEEYNFDGFRFDGITSMLYVHHGINMGFTGNYNEYFSEATDVDAVVYLMLANNLIHKIFPDATVIAEDVSGMPGLGRPVSEGGI
GFDYRLAMAIPDKWIDYLKNKNDEDWSMKEVTLSLTNRRYTEKCIAYAESHDQSIVGDKTIAFLLMDKEMYSGMSCLTDASPVVDRGIAL
HKMIHFFTMALGGEGYLNFMGNEFGHPEWIDFPREGKIGVMTNVDASGXLADSEHLRYKFMNAFDRAMNSLDEKFSFLASGKQIVSSMDD
DNKVVVFERGDLVFVFNFHPKNTYEGYKVGCDLPGKYRVALDSDAWEFGGHGRAGHDVDHFTSPEGIPGVPETNFNGRPNPSKXLSPART
CVAYYRVDERMSETEVYQTDICSELLPTANIEESDEKLKDSLSTNISNVDELMSETEVYQTDISSELLPTASIEESDEKLKDSLSTNISN
IGQTVVVSVEERDKELKDSPSVSIISDVVPTEWDDSDANVWGEDYQMIDRSFYVGDLGPVHDXLQGGSID
Predicted Coding Sequence 
XXCCCGTCTGTAAGCATCATTAGTGATGTTGTTCCAGCTGAATGGGATGATTCAGATGCAAACGTCTGGGGTGAGAACAACAAGAAGGTT
AAAGCTGAAGCAAAGTACCATAATTTAATCAATGGAAATAATTTCAATGTTTTATCAAAACCCATTCGAGGATCTTTTCCATCTTTCTCA
CCTAAAGTTTCTTCAGGGGCTTCTAGAAATAAGATATGTTTTCCTTCTCAACATAGTACTGGACTGAAGTTTGGATCTCAGGAACGGTCT
TGGGATATTTCTTCCACCCCAAAATCAAGAGTTAGAAAAGATGAAAGGATGAAGCACAGTTCAGCTATTTCCGCTGTTTTGACCGATGAC
AATTCGACAATGGCACCCCTAGAGGAAGATGTCAAGACTGAAAATATTGGCCTCCTAAATTTGGATCCAACTTTGGAACCTTATCTAGAT
CACTTCAGACACAGAATGAAGAGATATGTGGATCAGAAAATGCTCATTGAAAAATATGAGGGACCCCTTGAGGAATTTGCTCAAGGTTAT
TTAAAATTTGGATTCAACAGGGAAGATGGTTGCATAGTCTATCGTGAATGGGCTCCTGCTGCTCAGGAAGCAGAAGTTATTGGCGATTTC
AATGGATGGAACGGTTCTAACCACATGATGGAGAAGGACCAGTTTGGTGTTTGGAGTATTAGAATTCCTGATGTTGACAGTAAGCCAGTC
ATTCCACACAACTCCAGAGTTAAGTTTCGTTTCAAACATGGTAATGGAGTGTGGGTAGATCGTATCCCTGCTTGGATAAAGTATGCCACT
GCAGACGCCACAAAGTTTGCAGCACCATATGATGGTGTCTACTGGGACCCACCACCTTCAGAAAGGTACCACTTCAAATACCCTCGCCCT
CCCAAACCCCGAGCCCCACGAATCTATGAAGCACATGTCGGCATGAGCAGCTCTGAGCCACGTGTAAATTCGTATCGTGAGTTTGCAGAT
GATGTTTTACCTCGGATTAAGGCAAATAACTATAATACTGTCCAGTTGATGGCCATAATGGAACATTCTTACTATGGATCATTTGGATAT
CATGTTACAAACTTTTTTGCTGTGAGCAATAGATATGGAAACCCGGAGGACCTAAAGTATCTGATAGATAAAGCACATAGCTTGGGTTTA
CAGGTTCTGGTGGATGTAGTTCACAGTCATGCAAGCAATAATGTCACTGATGGCCTCAATGGCTTTGATATTGGCCAAGGTTCTCAAGAA
TCCTACTTTCATGCTGGAGAGCGAGGGTACCATAAGTTGTGGGATAGCAGGCTGTTCAACTATGCCAATTGGGAGGTTCTTCGTTTCCTT
CTTTCCAACTTGAGGTGGTGGCTAGAAGAGTATAACTTTGACGGATTTCGATTTGATGGAATAACTTCTATGCTGTATGTTCATCATGGA
ATCAATATGGGATTTACAGGAAACTATAATGAGTATTTCAGCGAGGCTACAGATGTTGATGCTGTGGTCTATTTAATGTTGGCCAATAAT
CTGATTCACAAGATTTTCCCAGATGCAACTGTTATTGCCGAAGATGTTTCTGGTATGCCGGGCCTTGGCCGGCCTGTTTCTGAGGGAGGA
ATTGGTTTTGATTACCGCCTGGCAATGGCAATCCCAGATAAGTGGATAGATTATTTAAAGAATAAGAATGATGAAGATTGGTCCATGAAG
GAAGTAACATTGAGTTTGACAAATAGGAGATATACAGAGAAGTGTATAGCATATGCGGAGAGCCATGATCAGTCTATTGTTGGTGACAAG
ACCATTGCATTTCTCCTAATGGACAAAGAGATGTATTCTGGCATGTCTTGCTTGACAGATGCTTCTCCTGTTGTTGATCGAGGAATTGCG
CTTCACAAGATGATCCATTTTTTCACAATGGCCTTGGGAGGAGAGGGGTACCTCAATTTCATGGGTAACGAGTTTGGCCATCCTGAGTGG
ATTGACTTCCCTAGAGAGGGCAAAATTGGTGTTATGACAAATGTAGACGCCAGTGGAAXCCTCGCGGATAGCGAACACTTGAGATACAAG
TTTATGAATGCATTTGATAGAGCTATGAATTCGCTCGATGAAAAGTTCTCATTCCTCGCATCAGGAAAACAGATAGTAAGCAGCATGGAT
GATGATAATAAGGTTGTTGTGTTTGAACGTGGTGACCTGGTATTTGTATTCAACTTCCACCCAAAGAACACATACGAAGGGTATAAAGTT
GGATGTGACTTGCCAGGGAAGTACAGAGTTGCACTGGACAGTGATGCTTGGGAATTTGGTGGCCATGGAAGAGCTGGTCATGATGTTGAC
CATTTCACATCACCAGAAGGAATACCTGGAGTTCCAGAAACAAATTTCAATGGTCGTCCAAATCCTTCAAAGXTGCTGTCTCCTGCGCGA
ACATGTGTGGCTTATTACAGAGTTGACGAACGCATGTCAGAAACTGAAGTTTACCAGACAGACATTTGTAGTGAGCTACTACCAACAGCC
AATATCGAGGAGAGTGACGAGAAACTTAAAGATTCGTTATCTACAAATATCAGTAACGTTGACGAACTCATGTCAGAAACTGAAGTTTAC
CAGACAGACATTTCTAGTGAGCTACTACCAACAGCCAGTATCGAGGAGAGTGACGAGAAACTTAAAGATTCATTATCTACAAATATCAGT
AACATTGGTCAGACTGTTGTAGTTTCTGTTGAGGAGAGAGACAAGGAACTTAAAGATTCACCATCTGTAAGCATCATTAGTGATGTTGTT
CCAACTGAATGGGATGATTCGGATGCAAACGTCTGGGGTGAGGACTATCAGATGATTGATCGATCCTTCTACGTTGGTGATCTTGGTCCX
GTGCATGATGXTCTTCAGGGTGGTAGCATTGACTGA\
Edits in Original Sequence 
(5')XXCCCGTCTGTAAGCATCATTAGTGATGTTGTTCCAGCTGAATGGGATGATTCAGATGCAAACGTCTGGGGTGAGAACAtACAAGA
AGGTTAAAGCTGAAGCAAAGTACCATAATTTAATCAATGGAAAtTAATTTCAATGTTTTATCAAAACCCATTCGAGGATCTTTTCCATCT
TTCTCACCTAAAGTTTCTTCAGGGGCTTCTAGAAATAAGATATGTTTTCCTTCTCAACATAGTACTGGACTGAAGTTTGGATCTCAGGAA
CGGTCTTGGGATATTTCTTCCACCCCAAAATCAAGAGTTAGAAAAGATGAAAGGATGAAGCACAGTTCAGCTATTTCCGCTGTTTTGACC
GATGACAATTCGACAATGGCACCCCTAGAGGAAGATGTCAAGACTGAAAATATTGGCCTCCTAAATTTGGATCCAACTTTGGAACCTTAT
CTAGATCACTTCAGACACAGAATGAAGAGATATGTGGATCAGAAAATGCTCATTGAAAAATATGAGGGACCCCTTGAGGAATTTGCTCAA
GGTTATTTAAAATTTGGATTCAACAGGGAAGATGGTTGCATAGTCTATCGTGAATGGGCTCCTGCTGCTCAGGAAGCAGAAGTTATTGGC
GATTTCAATGGATGGAACGGTTCTAACCACATGATGGAGAAGGACCAGTTTGGTGTTTGGAGTATTAGAATTCCTGATGTTGACAGTAAG
CCAGTCATTCCACACAACTCCAGAGTTAAGTTTCGTTTCAAACATGGTAATGGAGTGTGGGTAGATCGTATCCCTGCTTGGATAAAGTAT
GCCACTGCAGACGCCACAAAGTTTGCAGCACCATATGATGGTGTCTACTGGGACCCACCACCTTCAGAAAGGTACCACTTCAAATACCCT
CGCCCTCCCAAACCCCGAGCCCCACGAATCTATGAAGCACATGTCGGCATGAGCAGCTCTGAGCCACGTGTAAATTCGTATCGTGAGTTT
GCAGATGATGTTTTACCTCGGATTAAGGCAAATAACTATAATACTGTCCAGTTGATGGCCATAATGGAACATTCTTACTATGGATCATTT
GGATATCATGTTACAAACTTTTTTGCTGTGAGCAATAGATATGGAAACCCGGAGGACCTAAAGTATCTGATAGATAAAGCACATAGCTTG
GGTTTACAGGTTCTGGTGGATGTAGTTCACAGTCATGCAAGCAATAATGTCACTGATGGCCTCAATGGCTTTGATATTGGCCAAGGTTCT
CAAGAATCCTACTTTCATGCTGGAGAGCGAGGGTACCATAAGTTGTGGGATAGCAGGCTGTTCAACTATGCCAATTGGGAGGTTCTTCGT
TTCCTTCTTTCCAACTTGAGGTGGTGGCTAGAAGAGTATAACTTTGACGGATTTCGATTTGATGGAATAACTTCTATGCTGTATGTTCAT
CATGGAATCAATATGGGATTTACAGGAAACTATAATGAGTATTTCAGCGAGGCTACAGATGTTGATGCTGTGGTCTATTTAATGTTGGCC
AATAATCTGATTCACAAGATTTTCCCAGATGCAACTGTTATTGCCGAAGATGTTTCTGGTATGCCGGGCCTTGGCCGGCCTGTTTCTGAG
GGAGGAATTGGTTTTGATTACCGCCTGGCAATGGCAATCCCAGATAAGTGGATAGATTATTTAAAGAATAAGAATGATGAAGATTGGTCC
ATGAAGGAAGTAACATTGAGTTTGACAAATAGGAGATATACAGAGAAGTGTATAGCATATGCGGAGAGCCATGATCAGTCTATTGTTGGT
GACAAGACCATTGCATTTCTCCTAATGGACAAAGAGATGTATTCTGGCATGTCTTGCTTGACAGATGCTTCTCCTGTTGTTGATCGAGGA
ATTGCGCTTCACAAGATGATCCATTTTTTCACAATGGCCTTGGGAGGAGAGGGGTACCTCAATTTCATGGGTAACGAGTTTGGCCATCCT
GAGTGGATTGACTTCCCTAGAGAGGGCAAtAATTGGTGTTATGACAAATGTAGACGCCAGTGGAAXCCTCGCGGATAGCGAACACTTGAG
ATACAAGTTTATGAATGCATTTGATAGAGCTATGAATTCGCTCGATGAAAAGTTCTCATTCCTCGCATCAGGAAAACAGATAGTAAGCAG
CATGGATGATGATAATAAGGTTGTTGTGTTTGAACGTGGTGACCTGGTATTTGTATTCAACTTCCACCCAAAGAACACATACGAAGGGTA
TAAAGTTGGATGTGACTTGCCAGGGAAGTACAGAGTTGCACTGGACAGTGATGCTTGGGAATTTGGTGGCCATGGAAGAGCTGGTCATGA
TGTTGACCATTTCACATCACCAGAAGGAATACCTGGAGTTCCAGAAACAAATTTCAATGGTCGTCCAAATCCTTCAAAGXTGCTGTCTCC
TGCGCGAACATGTGTGGCTTATTACAGAGTTGACGAACGCATGTCAGAAACTGAAGTTTACCAGACAGACATTTGTAGTGAGCTACTACC
AACAGCCAATATCGAGGAGAGTGACGAGAAACTTAAAGATTCGTTATCTACAAATATCAGTAACGTTGACGAACTCATGTCAGAAACTGA
AGTTTACCAGACAGACATTTCTAGTGAGCTACTACCAACAGCCAGTATCGAGGAGAGTGACGAGAAACTTAAAGATTCATTATCTACAAA
TATCAGTAACATTGGTCAGACTGTTGTAGTTTCTGTTGAGGAGAGAGACAAGGAACTTAAAGATTCACCATCTGTAAGCATCATTAGTGA
TGTTGTTCCAACTGAATGGGATGATTCGGATGCAAACGTCTGGGGTGAGGACTAgTCAGATGATTGATCGATCCTTCTACGTTGGTGATC
TTGGTCCXGTGCATGATGXTCTTCAGGGTGGTAGCATTGACTGA\(3')TGGCATCATAGTTTTTTGTTTTAAAGTATTTCCTCTATGCA
TATTATTAGCATCCAATAAATTTACTGGTTGTTGTACATAGAAAAAGTGCATTTGCATGTATGTGTTCTCTGAAATTTTCCCCAGTTTTT
GGTGCTTTGCCTTTGGAGCCAAGTCTCTATATGTATAAGAAAACTAAGAACAATCACATATATCAAATATTAG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan