Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U269363

Score 
585
Direction 
Forward
Predicted Peptide Sequence 
KVDKFIGGESSLPLHEIGSNAGGDGGRYYLGMFLGGAYEEALGGLHNLFGGPSVVRVLQSDSPHSFAVTRSVPGPSCADVLRAMQFEPEL
MFETLKHRAEEFLEQGEGEGEDKGLAFASLTSSLAQSFHNMPYLVSSSSSCCFTAEATATASANANANNGGYYYYSEDNAADCATEEDEI
WSY
Predicted Coding Sequence 
XGAAAGGTTGATAAGTTCATTGGGGGCGAATCAAGCTTGCCGCTCCATGAAATTGGAAGTAATGCCGGTGGTGATGGTGGGCGGTATTAT
CTGGGGATGTTTTTGGGTGGGGCTTATGAGGAGGCGCTCGGAGGACTCCACAATCTATTTGGTGGACCAAGCGTTGTTCGCGTGTTGCAG
AGCGATAGCCCTCACAGCTTTGCGGTGACTCGCTCTGTCCCTGGCCCATCCTGTGCTGACGTTCTCCGGGCGATGCAGTTTGAGCCTGAA
CTCATGTTCGAGACTCTCAAGCACCGTGCAGAGGAATTCTTGGAACAAGGAGAAGGAGAAGGAGAAGATAAAGGTCTTGCCTTTGCATCT
TTGACCAGCAGCTTAGCTCAGTCCTTCCACAACATGCCTTACCTTGTGTCGTCGTCTTCGTCTTGCTGCTTCACTGCAGAAGCCACTGCC
ACTGCCAGTGCCAATGCCAATGCCAATAATGGTGGCTATTACTATTACAGTGAAGACAATGCTGCAGATTGTGCAACAGAGGAAGATGAG
ATTTGGTCCTACTGA\
Edits in Original Sequence 
(5')XGAAAGGTTGATAAGTTCATTGGGGGCGAATCAAGCTTGCCGCTCCATGAAATTGGAAGTAATGCCGGTGGTGATGGTGGGCGGTA
TTATCTGGGGATGTTTTTGGGTGGGGCTTATGAGGAGGCGCTCGGAGGACTCCACAATCTATTTGGTGGACCAAGCGTTGTTCGCGTGTT
GCAGAGCGATAGCCCTCACAGCTTTGCGGTGACTCGCTCTGTCCCTGGCCCATCCTGTGCTGACGTTCTCCGGGCGATGCAGTTTGAGCC
TGAACTCATGTTCGAGACTCTCAAGCACCGTGCAGAGGAATTCTTGGAACAAGGAGAAGGAGAAGGAGAAGATAAAGGTCTTGCCTTTGC
ATCTTTGACCAGCAGCTTAGCTCAGTCCTTCCACAACATGCCTTACCTTGTGTCGTCGTCTTCGTCTTGCTGCTTCACTGCAGAAGCCAC
TGCCACTGCCAGTGCCAATGCCAATGCCAATAATGGTGGCTATTACTATTACAGTGAAGACAATGCTGCAGATTGTGCAACAGAGGAAGA
TGAGATTTGGTCCTACTGA\(3')ACTGCTTGAAGTGTCTTGTTAGCATCTCCAGTTTGTCGTCGAGGTCGTCTGTTTTTTTCAATAATC
CCACCCCTTAGTTGGTGCATGTTACATTTCGTTTGTCTAGTTTGAAAAAGATGCAGTAGACTGTCATCTATGTTGCAAGTAAGCTTATGT
TATGACTGAATCAATTTCATGTATGGTTCGTCCTCTTTTCCGCCTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AANAAAAGGGGGGGGGGGGGGAGAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan