ESTScan Details for Unigene SGN-U269398

Score 
828
Direction 
Forward
Predicted Peptide Sequence 
MALPNTFSLSASKSLGNFSSCQPHFSLFPDHRYGRRHRISAVHAAAEQEKWSLGSWKNKKALQLPEYPNEENLEIVLKILESNPPLVFAG
EARNLEKKLGEAALGKAFLLQGGDCAESFKEFNANNIRDTFRILLQMSVVLMFGGEVPVIKVGRMAGQFAKPRSDPFEEINGVKLPSYKG
DNINGDTFDEKSRIPDPRKLIRAYX
Predicted Coding Sequence 
ATGGCTTTACCAAATACCTTTTCATTGTCAGCATCCAAATCCCTAGGTAACTTTTCTTCATGTCAGCCCCATTTCTCCCTTTTTCCCGAC
CACCGATATGGGAGGCGCCACCGCATCTCCGCCGTACACGCGGCGGCGGAGCAAGAAAAATGGAGTCTTGGAAGTTGGAAAAACAAGAAG
GCTCTGCAACTTCCTGAATACCCAAATGAAGAAAATCTTGAAATTGTGCTTAAGATTCTTGAATCAAACCCACCCCTTGTGTTTGCTGGT
GAAGCAAGGAATTTGGAGAAGAAGCTTGGTGAGGCTGCATTGGGGAAAGCTTTTTTGTTACAAGGTGGAGATTGTGCTGAGAGTTTTAAG
GAGTTTAATGCTAATAATATTCGTGATACTTTTAGGATTTTGCTTCAGATGAGTGTTGTTCTTATGTTTGGTGGAGAAGTTCCTGTGATT
AAGGTTGGAAGAATGGCCGGCCAGTTTGCAAAACCAAGATCAGATCCGTTCGAGGAGATAAATGGAGTGAAGTTACCAAGTTACAAGGGT
GACAATATCAATGGTGATACATTTGATGAGAAGTCACGAATTCCAGATCCTCGTAAGCTTATTCGGGCGTATAXX\
Edits in Original Sequence 
CAAGGATGTAAAATTTCTTATATTTTACTTGAAGTATATTTTAATTTTCCTATTTTAGAAATTATGTAGATTTTAAAATATGCATGTAGT
TTTTTTTTAATTAAAAAA
(5')ATGGCTTTACCAAATACCTTTTCATTGTCAGCATCCAAATCCCTAGGTAACTTTTCTTCATGTCAGCC
CCATTTCTCCCTTTTTCCCGACCACCGATATGGGAGGCGCCACCGCATCTCCGCCGTACACGCGGCGGCGGAGCAAGAAAAATGGAGTCT
TGGAAGTTGGAAAAACAAGAAGGCTCTGCAACTTCCTGAATACCCAAATGAAGAAAATCTTGAAATTGTGCTTAAGATTCTTGAATCAAA
CCCACCCCTTGTGTTTGCTGGTGAAGCAAGGAATTTGGAGAAGAAGCTTGGTGAGGCTGCATTGGGGAAAGCTTTTTTGTTACAAGGTGG
AGATTGTGCTGAGAGTTTTAAGGAGTTTAATGCTAATAATATTCGTGATACTTTTAGGATTTTGCTTCAGATGAGTGTTGTTCTTATGTT
TGGTGGAGAAGTTCCTGTGATTAAGGTTGGAAGAATGGCCGGCCAGTTTGCAAAACCAAGATCAGATCCGTTCGAGGAGATAAATGGAGT
GAAGTTACCAAGTTACAAGGGTGACAATATCAATGGTGATACATTTGATGAGAAGTCACGAATTCCAGATCCTCGTAAGCTTATTCGGGC
GTATAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan