ESTScan Details for Unigene SGN-U269418

Score 
2262
Direction 
Forward
Predicted Peptide Sequence 
EVAEFRRQTLAPPSPSPVVPPLSFHNHILSPYFLDXFSIISNTIRLSEKAWRVYKAAFIVSCPKCSCWWMRSYSSSKLRAKFSLWLPGVA
SXLISYSEEIINGEPIFISSNCCPIKAHKYEPAGLAFHSAALRLIGHVEKEDPKDGKEDVPNDKEQTFAYSSESYSSKGKKKSSTGEKVQ
DHYALLGLSNLRYLASEDQIRKSYRDAALRHHPDKLASLLLAEETEAAKQAKKEEIENHFKAIQEAYEVLMDPVRRRIYDSTDEFDDEIP
TECAPQDFFKVFGPAFLRNGRWSVTQPIPSLGDENTPIKEVDSFYNFWYSFKSWREFPHTDEFDLEQAESRDHKRWMERQNAKLSEKARK
EETARVRTLVDNAYRKDPRILGRKEAEKAEKQRKKEAKLLAKKLQEEEAIRIVEEEKRKKEEEGKKAAEVALQQKKLKEKEKKLLRKERS
RLRTLAAPVLSQRLLGLTDDDVEGLCMSLDIEQLRNLCDKADGKGELVISELLRGALGHEHNPKYENKDEKIKSQQNGSLESKKQVPLMS
SEKKEKPWSKEEIDLLRKGMLKYPKGTSRRWEVISDYIGTARTVEEILKATKTVLLQKPDSAKAFDSFLEKRKPAPTIVSPLSTREEVEG
VENSSKPESGSAKVADSQETPSQNTNSQNTDDAPAANGVSSSSDSDIWSAVQEKALVQALKTFPKETSQRWERVATAVPGKTMNQCKKKF
ALLKENFRNKKSAV
Predicted Coding Sequence 
XXTGAGGTAGCTGAGTTCCGCAGACAAACCCTAGCTCCTCCTTCTCCTTCACCCGTCGTCCCGCCGCTCTCTTTTCATAACCACATACTT
AGCCCGTATTTTTTAGATXCATTCTCCATAATCAGTAACACAATTAGATTATCGGAAAAGGCTTGGAGAGTGTATAAGGCTGCTTTTATC
GTCTCTTGCCCCAAGTGTAGCTGTTGGTGGATGCGTTCTTATTCATCTTCTAAGTTGAGGGCTAAGTTTTCTCTATGGCTTCCAGGAGTA
GCATCCGXTCTTATTTCATACTCGGAAGAGATTATAAATGGTGAACCAATCTTTATTTCCTCTAACTGCTGTCCTATTAAAGCTCACAAA
TATGAGCCTGCTGGACTTGCTTTTCACTCTGCTGCTCTTAGACTGATTGGGCATGTTGAGAAAGAAGACCCCAAAGATGGCAAAGAAGAT
GTTCCTAATGACAAGGAACAGACATTTGCCTATTCATCAGAGTCATACAGCTCTAAGGGGAAAAAGAAGTCTTCTACCGGCGAAAAGGTA
CAAGATCATTATGCATTGTTAGGGTTGAGCAATCTAAGGTATCTTGCTTCTGAGGATCAGATAAGGAAGAGCTATCGTGATGCTGCATTG
AGGCATCATCCTGACAAGCTGGCTTCACTTCTTCTAGCTGAGGAAACTGAAGCTGCAAAACAAGCCAAGAAGGAGGAAATAGAAAACCAC
TTCAAAGCTATTCAGGAAGCATATGAGGTTCTTATGGACCCTGTTAGAAGAAGGATTTATGACTCCACCGATGAATTTGATGATGAAATC
CCAACTGAATGTGCTCCACAAGATTTTTTTAAAGTCTTTGGACCTGCATTTTTAAGGAATGGTCGTTGGTCCGTCACCCAACCCATCCCT
TCATTAGGTGATGAGAATACTCCAATTAAAGAAGTGGATAGCTTTTATAATTTCTGGTACAGCTTCAAAAGTTGGAGAGAGTTCCCACAT
ACTGATGAGTTTGATCTTGAACAAGCTGAATCTCGTGATCACAAGAGGTGGATGGAAAGGCAGAATGCGAAACTTTCAGAGAAGGCCAGA
AAGGAAGAAACCGCCAGGGTGCGTACACTTGTTGACAATGCCTACAGAAAAGACCCTAGAATCTTGGGAAGAAAGGAGGCGGAGAAAGCA
GAGAAGCAGAGAAAGAAGGAAGCTAAACTACTTGCAAAGAAATTACAGGAGGAAGAAGCAATTAGGATTGTTGAAGAGGAAAAGCGTAAG
AAAGAGGAGGAGGGAAAAAAAGCTGCTGAAGTTGCTTTGCAGCAGAAGAAGTTGAAGGAGAAAGAAAAGAAATTATTGCGAAAAGAGCGT
AGTCGTTTAAGAACCCTTGCTGCTCCTGTTTTGTCTCAGCGTTTGCTTGGGCTAACTGATGACGATGTAGAAGGTCTATGCATGTCACTT
GACATTGAGCAACTGAGGAACTTATGTGATAAAGCCGATGGAAAGGGTGAGCTTGTTATCTCTGAACTTCTCAGGGGAGCACTTGGACAT
GAACACAACCCAAAATATGAGAATAAAGATGAAAAGATTAAGTCGCAGCAAAATGGTTCTCTGGAGAGTAAAAAACAAGTTCCTCTGATG
AGCAGTGAGAAAAAGGAGAAACCTTGGAGCAAAGAAGAAATTGATCTTTTGAGGAAGGGGATGCTGAAATATCCTAAAGGAACTTCTCGA
AGATGGGAAGTTATTTCTGATTATATTGGTACCGCAAGGACAGTTGAAGAGATCCTGAAGGCTACAAAAACAGTTCTGCTCCAGAAACCC
GACTCTGCTAAAGCCTTTGACTCCTTCCTTGAGAAAAGAAAGCCAGCACCAACTATTGTTTCTCCTCTTTCCACGAGGGAAGAAGTAGAG
GGAGTAGAAAATAGTAGCAAGCCTGAAAGTGGAAGTGCCAAAGTAGCTGATTCTCAGGAGACCCCTAGTCAAAACACAAACAGCCAGAAC
ACTGATGACGCACCTGCAGCAAACGGAGTTTCTTCGAGTTCTGATTCAGACATATGGTCTGCTGTTCAAGAAAAAGCTTTAGTTCAAGCT
CTGAAAACCTTCCCCAAGGAAACCAGCCAGCGGTGGGAACGAGTTGCAACTGCTGTCCCTGGGAAGACCATGAACCAGTGTAAAAAAAAG
TTTGCATTACTCAAAGAGAATTTCAGGAACAAGAAAAGTGCAGTGTGA\
Edits in Original Sequence 
(5')XXTGAGGTAGCTGAGTTCCGCAGACtAAACCCTAGCTCCTCCTTCTCCTTCACCCGTCGTCCCGCCGCTCTCTTTTCATAACCACA
TaACTTAGCCCGTATTTTTTAGATXCATTCTCCATAATCAGTAACACAATTAGATTATCGGAAAAGGCTTGGAGAGTGTATAAGGCTGCT
TTTATCGTCTCTTGCCCCAAGTGTAGCTGTTGGTGGATGCGTTCTTATTCATCTTCTAtAGTTGAGGGCTAAGTTTTCTCTATGGCTTCC
AGGAGTAGCATCCGXTCTTATTTCATACTCGGAAGAGATTATAAATGGTGAACCAATCTTTATTTCCTCTAACTGCTGTCCTATTAAAGC
TCACAAATATGAGCCTGCTGGACTTGCTTTTCACTCTGCTGCTCTTAGACTGATTGGGCATGTTGAGAAAGAAGACCCCAAAGATGGCAA
AGAAGATGTTCCTAATGACAAGGAACAGACATTTGCCTATTCATCAGAGTCATACAGCTCTAAGGGGAAAAAGAAGTCTTCTACCGGCGA
AAAGGTACAAGATCATTATGCATTGTTAGGGTTGAGCAATCTAAGGTATCTTGCTTCTGAGGATCAGATAAGGAAGAGCTATCGTGATGC
TGCATTGAGGCATCATCCTGACAAGCTGGCTTCACTTCTTCTAGCTGAGGAAACTGAAGCTGCAAAACAAGCCAAGAAGGAGGAAATAGA
AAACCACTTCAAAGCTATTCAGGAAGCATATGAGGTTCTTATGGACCCTGTTAGAAGAAGGATTTATGACTCCACCGATGAATTTGATGA
TGAAATCCCAACTGAATGTGCTCCACAAGATTTTTTTAAAGTCTTTGGACCTGCATTTTTAAGGAATGGTCGTTGGTCCGTCACCCAACC
CATCCCTTCATTAGGTGATGAGAATACTCCAATTAAAGAAGTGGATAGCTTTTATAATTTCTGGTACAGCTTCAAAAGTTGGAGAGAGTT
CCCACATACTGATGAGTTTGATCTTGAACAAGCTGAATCTCGTGATCACAAGAGGTGGATGGAAAGGCAGAATGCGAAACTTTCAGAGAA
GGCCAGAAAGGAAGAAACCGCCAGGGTGCGTACACTTGTTGACAATGCCTACAGAAAAGACCCTAGAATCTTGGGAAGAAAGGAGGCGGA
GAAAGCAGAGAAGCAGAGAAAGAAGGAAGCTAAACTACTTGCAAAGAAATTACAGGAGGAAGAAGCAATTAGGATTGTTGAAGAGGAAAA
GCGTAAGAAAGAGGAGGAGGGAAAAAAAGCTGCTGAAGTTGCTTTGCAGCAGAAGAAGTTGAAGGAGAAAGAAAAGAAATTATTGCGAAA
AGAGCGTAGTCGTTTAAGAACCCTTGCTGCTCCTGTTTTGTCTCAGCGTTTGCTTGGGCTAACTGATGACGATGTAGAAGGTCTATGCAT
GTCACTTGACATTGAGCAACTGAGGAACTTATGTGATAAAGCCGATGGAAAGGGTGAGCTTGTTATCTCTGAACTTCTCAGGGGAGCACT
TGGACATGAACACAACCCAAAATATGAGAATAAAGATGAAAAGATTAAGTCGCAGCAAAATGGTTCTCTGGAGAGTAAAAAACAAGTTCC
TCTGATGAGCAGTGAGAAAAAGGAGAAACCTTGGAGCAAAGAAGAAATTGATCTTTTGAGGAAGGGGATGCTGAAATATCCTAAAGGAAC
TTCTCGAAGATGGGAAGTTATTTCTGATTATATTGGTACCGCAAGGACAGTTGAAGAGATCCTGAAGGCTACAAAAACAGTTCTGCTCCA
GAAACCCGACTCTGCTAAAGCCTTTGACTCCTTCCTTGAGAAAAGAAAGCCAGCACCAACTATTGTTTCTCCTCTTTCCACGAGGGAAGA
AGTAGAGGGAGTAGAAAATAGTAGCAAGCCTGAAAGTGGAAGTGCCAAAGTAGCTGATTCTCAGGAGACCCCTAGTCAAAACACAAACAG
CCAGAACACTGATGACGCACCTGCAGCAAACGGAGTTTCTTCGAGTTCTGATTCAGACATATGGTCTGCTGTTCAAGAAAAAGCTTTAGT
TCAAGCTCTGAAAACCTTCCCCAAGGAAACCAGCCAGCGGTGGGAACGAGTTGCAACTGCTGTCCCTGGGAAGACCATGAACCAGTGTAA
AAAAAAGTTTGCATTACTCAAAGAGAATTTCAGGAACAAGAAAAGTGCAGTGTGA\(3')GGTTAGTGGTGCTTGAAACTGCTGAGTCTA
GTTTTTTTTTTTATTTCCATCTTTTTATTGTTCAGGCAGCCGCAACAAGCTCACTCTTGAAATGCATTGTGACAACACACCCCAGTCCAT
TTTCAGTACCATTTTTGTCATTAAGCAGTAGTATTTACATATCTACTATTCAGTACGGCATTGTGAAGTTACTATACTGGAATACATTAA
TATTTGATGGGAAATACCGATGATACCTAAAGTTATTTATCTTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan