Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U269476

Score 
1083
Direction 
Forward
Predicted Peptide Sequence 
MDKKKVVAPLVCHGHSRPVVDLSYSPITPDGXLPHQCQQGFYANAEKWRDXEIGLEHLKGIKEPCGVVXLDKHALRAASASADFSAKLWD
ALTGDVLHSFDHKHIVRACAFSEDTNLLLTGGFEKILRIFDLNRPDAPPREIDSSPGSVRTVAWLHSDQTILSSSGDAGGLRLWDVRSGK
VVQILETKFPVTSAEVSQDGRYITTADGSSVKFWDANHFGLVKSHDLPCKVESASLEPKFGNRFIAGGEDMWVHVFDFHTGEEIGCNKGH
HGPVHCLRFSPGGESYASGSEDGTIRIWQLGPLGQIEDNSTANGSTTANANDGMSEVTQKIDELAVSETKKMEETQVDGVEQKVVDALIR
NLRVLYGFSFWKAVTGLTSEVFAYEIRLKLLIVLGILCLPEIVIISYIVFGVVFSVELREVPSSLLRFMLSLDLQLLLQTSQDVQTRIVA
NLVP
Predicted Coding Sequence 
ATGGATAAGAAGAAAGTTGTGGCACCGCTTGTTTGCCATGGGCATTCTCGTCCTGTTGTTGATCTGTCCTACAGTCCAATCACTCCTGAT
GGAXTTCTTCCTCATCAGTGCCAGCAAGGATTCTACGCCAATGCTGAGAAATGGAGAGACXTGGAGATTGGATTGGAACATTTGAAGGGC
ATAAAGGAGCCGTGTGGAGTTGTTGXTCTGGATAAACATGCTCTTCGTGCTGCATCTGCATCTGCCGATTTCAGCGCGAAATTATGGGAT
GCATTGACTGGGGATGTATTACACTCATTTGACCACAAGCACATAGTTCGAGCATGTGCCTTTTCAGAGGATACAAATCTGCTACTCACC
GGTGGTTTTGAAAAAATTCTTCGGATATTTGATTTAAACCGACCTGATGCACCTCCAAGGGAAATTGACAGCTCTCCTGGTTCAGTAAGG
ACAGTTGCTTGGCTGCACAGTGATCAAACCATTTTGAGTTCCTCTGGAGATGCTGGTGGATTGAGGTTATGGGACGTGAGGAGCGGTAAA
GTTGTTCAAATCCTTGAAACTAAGTTTCCTGTAACCAGTGCTGAAGTAAGTCAGGATGGTCGTTACATAACAACTGCTGATGGTTCCTCT
GTCAAGTTTTGGGATGCTAACCACTTTGGATTGGTGAAGAGTCACGACTTGCCTTGCAAAGTTGAATCTGCTTCCCTGGAACCAAAGTTC
GGTAATAGGTTCATTGCCGGAGGAGAAGATATGTGGGTTCATGTCTTTGATTTTCACACTGGAGAGGAAATTGGATGCAACAAGGGACAC
CACGGTCCTGTGCACTGTTTGCGGTTCTCTCCAGGAGGTGAATCCTATGCCTCAGGATCTGAAGATGGGACTATTAGAATATGGCAGCTG
GGCCCTCTTGGTCAGATTGAGGACAACTCCACAGCAAACGGGTCTACTACTGCAAATGCCAATGATGGTATGAGCGAGGTGACCCAAAAG
ATTGACGAGTTGGCTGTTTCAGAAACAAAGAAGATGGAAGAGACACAGGTCGATGGTGTGGAGCAGAAGGTAGTTGATGCXCTGATTAGG
AATTTAAGGGTTTTGTATGGTTTCTCCTTTTGGAAAGCTGTAACTGGCTTGACTTCGGAGGTTTTTGCTTATGAAATAAGACTTAAGCTT
TTGATAGTGCTGGGTATTCTTTGCTTGCCCGAGATCGTAATCATCAGTTATATAGTCTTTGGAGTAGTTTTCTCTGTAGAACTGAGAGAA
GTACCTAGCTCTCTTCTCAGGTTCATGTTGTCCTTGGATTTGCAATTGCTTTTACAAACCAGTCAGGATGTCCAAACCAGAATAGTCGCA
AACCTAGTGCCTTAA\
Edits in Original Sequence 
ATAGTTTCAGTATATTTTTATTTTTTCTTTTTCTGTGGTTTTTGTATTTGTTTTTTTCTATATATTTTGTTTCTTAATTTGGTAATAATT
CGGAGTTGTGATCTATCCTTAGGGCTTCTTATATGAGTTGATAGGGTTAGAAAGGTGTGGATCCATCAAAGAAACATCAAATCTCAAAAT
TAGGGTTTCCCACCTTTTACAGTCGCGCCAGTTCCCCATCTATCTATACATACATATATATCTGATTGTGATTTTGTAGATCTTTTCAAA
TTTATGTTTTAATTCTATTTTTCTTTGATCTCACAACTCGGGAAAAGCAATTGTGCTTCAATTTTTTGTTCATCGGTCAATTGTCACTTT
CTTTCATTTGGGGACTTTTTTTTTTTTTGATCAATTTCGATTCTATCATATCGGCGCTGGGTTGGGTTTCTCGTAGAAATCATAATCTTT
GTGATTTGATTTAATTAGAATTGGCAGTA
(5')ATGGATAAGAAGAAAGTTGTGGCACCGCTTGTTTGCCATGGGCATTCTCGTCCTGTT
GTTGATCTGTCCTACAGTCCAATCACTCCTGATGGAXTTCTTCCTCATCAGTGCCAGCAAGGATTCTACGCCAATGCTGAGAAATGGAGA
GACXTGGAGATTGGATTGGAACATTTGAAGGGCATAAAGGAGCCGTGTGGAGTTGTTGXTCTGGATAAACATGCTCTTCGTGCTGCATCT
GCATCTGCCGATTTCAGCGCGAAATTATGGGATGCATTGACTGGGGATGTATTACACTCATTTGACCACAAGCACATAGTTCGAGCATGT
GCCTTTTCAGAGGATACAAATCTGCTACTCACCGGTGGTTTTGAAAAAATTCTTCGGATATTTGATTTAAACCGACCTGATGCACCTCCA
AGGGAAATTGACAGCTCTCCTGGTTCAGTAAGGACAGTTGCTTGGCTGCACAGTGATCAAACCATTTTGAGTTCCTCTGGAGATGCTGGT
GGATTGAGGTTATGGGACGTGAGGAGCGGTAAAGTTGTTCAAATCCTTGAAACTAAGTTTCCTGTAACCAGTGCTGAAGTAAGTCAGGAT
GGTCGTTACATAACAACTGCTGATGGTTCCTCTGTCAAGTTTTGGGATGCTAACCACTTTGGATTGGTGAAGAGTCACGACTTGCCTTGC
AAAGTTGAATCTGCTTCCCTGGAACCAAAGTTCGGTAATAGGTTCATTGCCGGAGGAGAAGATATGTGGGTTCATGTCTTTGATTTTCAC
ACTGGAGAGGAAATTGGATGCAACAAGGGACACCACGGTCCTGTGCACTGTTTGCGGTTCTCTCCAGGAGGTGAATCCTATGCCTCAGGA
TCTGAAGATGGGACTATTAGAATATGGCAGCTGGGCCCTCTTGGTCAGATTGAGGACAACTCCACAGCAAACGGGTCTACTACTGCAAAT
GCCAATGATGGTATGAGCGAGGTGACCCAAAAGATTGACGAGTTGGCTGTTTCAGAAACAAAGAAGATGGAAGAGACACAGGTCGATGGT
GTGGAGCAGAAGGTAGTTGATGCXCTGATTAGGAATTTAAGGGTTTTGTATGGTTTCTCCTTTTGGAAAGCTGTAACTGGCTTGACTTCG
GAGGTTTTTGCTTATGAAATAAGACTTAAGCTTTTGATAGTGCTGGGTATTCTTTGCTTGCCCGAGATCGTAATCATCAGTTATATAGTC
TTTGGAGTAGTTTTCTCTGTAGAACTGAGAGAAGTACCTAGCTCTCTTCTCAGGTTCATGTTGTCCTTGGATTTGCAATTGCTTTTACAA
ACCAGTCAGGATGTCCAAACCAGAATAGTCGCAAACCTAGTGCCTTAA\(3')TAGTATGAAAAAGTAAACTCTGTAACAAGGCTTAAAT
TCAATGAAATAGTACTGAGTTTTGACAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan