Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U269538

Score 
848
Direction 
Forward
Predicted Peptide Sequence 
MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVLSECKPKAKIVDLCEKGDAFIKEQTGNMYKNVKKKIERGVAFPTCISVNNTVCH
FSPLASDETVVEEGDILKIDMGCHIDGFIAVVGHTHVLHEGPVTGRAADVIAAANTAAEVALRLVRPGKKNSDVTEAIQKVVAAAYDWQD
WSRGVFGANXKIERQFVIGLGNPKVGIEAVFQIRDHKEVDERRILKRMEGLLPFDIVTX
Predicted Coding Sequence 
ATGTCGGACGACGAGAGAGAAGAGAAAGAATTGGATCTCACAAGTCCTGAGGTCGTCACCAAGTACAAGAGCGCCGCTGAAATTGTTAAC
AAGGCGCTGCAGTTGGTGTTGTCCGAATGCAAGCCAAAAGCAAAGATAGTTGATCTTTGTGAGAAAGGGGATGCCTTTATCAAAGAGCAA
ACTGGAAATATGTACAAGAATGTGAAGAAGAAGATTGAGAGAGGTGTTGCATTTCCAACATGTATTTCAGTTAATAACACCGTGTGCCAT
TTCTCTCCATTGGCTAGTGATGAGACAGTAGTGGAAGAAGGTGATATATTGAAGATTGATATGGGATGTCACATTGATGGATTTATTGCA
GTAGTTGGACATACACATGTTCTTCACGAAGGACCAGTTACTGGTAGAGCTGCTGATGTCATTGCAGCTGCTAATACAGCTGCTGAAGTT
GCTTTGAGACTTGTAAGACCAGGAAAGAAGAACTCGGATGTAACAGAAGCTATTCAGAAGGTTGTGGCTGCTGCTTATGACTGGCAAGAT
TGGTCGAGGGGTGTATTTGGAGCCAATXCAAAAATTGAAAGACAGTTTGTTATTGGATTGGGAAACCCAAAAGTTGGTATTGAGGCXGTG
TTCCAAATCCGTGACCACAAAGAAGTAGATGAACGCAGAATTTTGAAGAGAATGGAGGGTCTACTCCCATTTGATATCGTGACCAGX\
Edits in Original Sequence 
GGAAAGAGAAAAAAAAAATCTGTACTTTGTCTCCTTTTTATCACCTCATACACCTTTAACTTCACTAAAAACCCTAGCTTCCAAACCCTT
GTTGCCTCCATTTTTCTTCCATCGCAAAATCCCAATTTTGCTTCGAATTTGTGTGTTTGAATTAATAGCTGTTTTGTAACT
(5')ATGTC
GGACGACGAGAGAGAAGAGAAAGAATTGGATCTCACAAGTCCTGAGGTCGTCACCAAGTACAAGAGCGCCGCTGAAATTGTTAACAAGGC
GCTGCAGTTGGTGTTGTCCGAATGCAAGCCAAAAGCAAAGATAGTTGATCTTTGTGAGAAAGGGGATGCCTTTATCAAAGAGCAAACTGG
AAATATGTACAAGAATGTGAAGAAGAAGATTGAGAGAGGTGTTGCATTTCCAACATGTATTTCAGTTAATAACACCGTGTGCCATTTCTC
TCCATTGGCTAGTGATGAGACAGTAGTGGAAGAAGGTGATATATTGAAGATTGATATGGGATGTCACATTGATGGATTTATTGCAGTAGT
TGGACATACACATGTTCTTCACGAAGGACCAGTTACTGGTAGAGCTGCTGATGTCATTGCAGCTGCTAATACAGCTGCTGAAGTTGCTTT
GAGACTTGTAAGACCAGGAAAGAAGAACTCGGATGTAACAGAAGCTATTCAGAAGGTTGTGGCTGCTGcCTTATGACTGGCAAGATTGGT
CGAGGGGTGTATTTGGAGCCAATXCAAAAATTGAAAGACAGTTTGTTATTGGATTGGGAAACCCAAAAGTTGGTATTGAGGCXGTGTTCC
AAATCCGTGACCACAAAGAAGTAGATGAACGCAGAATTTTGAAGAGAATGGAGGGTCTACTCCCATTTGATATCGTGACCAGX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan