ESTScan Details for Unigene SGN-U269552

Score 
1594
Direction 
Forward
Predicted Peptide Sequence 
SFRVPSAHTLSSLSGRSPNSPTEKFIHLDAXKLEFGCPDANDSCAYQNGSFCLCDVTSFLNFRSCATDDTDTQSIAAKLSSSGLLRSQAL
IGGKWVDAYDGKTIKVHNPATGEVITDVPCMGGRETNDAISSAYDAFSSWSKLTAAERSKYLRKWYDLIMAHKEELGQLMTLEQGKPLKE
AIGEVSYGAGFIEFSAEEGKRIYGDIIPSPLADRRLFVLKQPVGVVGAITPWNFPLAMITRKVGPALACGCTVVIKPSELTPLTALAAAE
LSIQAGIPPGVVNVVMGNAPAIGDALLASPQVRKITFTGSTKVGKKLMEGAAATVKKVSLELGGNAPCIIFDDADLEVALKGALATKFRN
TGQTCVCANRILVQEGIYDKFANAFAKAVQNMKVGDGFTEGVEQGPLINEAAVQKVESFVEEATSKGAKVLVGGKRHSLGMTFYEPTVVT
GVNSEMLLAKEEVFGPVAPLLKFKTDEEAIQMANDTNAGLAAYIFSTNIKRAWRVTEALEYGIVGVNEGLVSTEVAPFGGVKQSGLGREG
SKYGMDEYLEMKYVCLGSMS
Predicted Coding Sequence 
XXCTCTTTTAGGGTTCCATCXGCTCACACACTCTCTTCACTCTCCGGTAGATCTCCAAATTCTCCGACGGAAAAGTTTATTCATTTGGAT
GCTXTGAAGTTGGAATTCGGGTGCCCTGATGCAAATGATTCGTGTGCGTACCAGAATGGCTCTTTCTGCTTGTGCGATGTTACATCGTTC
CTCAATTTCAGGTCCTGTGCGACTGATGACACAGACACACAAAGTATTGCTGCTAAGCTGAGCAGCTCTGGATTGTTGCGGAGTCAGGCT
CTTATTGGAGGGAAATGGGTTGATGCATATGATGGGAAGACTATAAAGGTCCACAATCCTGCAACAGGGGAGGTAATAACAGATGTGCCA
TGCATGGGAGGGAGGGAGACGAACGATGCAATTTCTTCTGCCTATGATGCATTTAGTTCATGGAGCAAACTTACTGCCGCTGAAAGGAGC
AAATATTTAAGGAAGTGGTATGATTTGATAATGGCCCATAAAGAAGAACTTGGACAGCTTATGACACTAGAGCAAGGGAAACCTCTGAAA
GAGGCCATTGGTGAAGTTAGTTATGGGGCTGGTTTTATTGAGTTCTCCGCTGAAGAGGGTAAGCGTATATATGGTGACATCATTCCATCA
CCATTAGCAGATAGGCGGTTATTTGTTTTAAAGCAACCAGTTGGTGTTGTTGGTGCAATTACTCCGTGGAATTTTCCCCTGGCTATGATT
ACCCGAAAAGTTGGCCCTGCTCTTGCTTGTGGTTGTACAGTGGTGATAAAACCATCTGAACTCACACCCTTGACTGCTTTAGCAGCAGCT
GAACTCTCCATTCAAGCTGGAATACCACCGGGCGTAGTGAATGTTGTTATGGGAAATGCACCTGCTATTGGAGACGCACTGCTTGCAAGC
CCACAGGTAAGAAAAATTACATTCACAGGTTCAACCAAGGTTGGGAAAAAATTGATGGAAGGTGCTGCTGCCACTGTTAAAAAGGTATCT
CTTGAGCTAGGCGGTAATGCACCTTGCATCATCTTTGATGACGCAGATCTTGAAGTAGCTTTAAAAGGAGCTCTGGCAACAAAGTTCCGT
AACACCGGACAAACATGTGTATGCGCGAACAGAATACTTGTGCAAGAAGGGATATATGATAAATTCGCAAATGCTTTTGCAAAAGCTGTC
CAAAACATGAAAGTTGGAGATGGTTTCACTGAAGGTGTGGAGCAAGGCCCTCTAATCAATGAAGCAGCAGTACAGAAGGTTGAATCTTTT
GTAGAAGAAGCTACTTCAAAGGGAGCCAAAGTCCTCGTTGGTGGGAAGAGACACAGCCTTGGCATGACTTTCTACGAGCCTACAGTCGTA
ACTGGAGTTAACAGTGAGATGCTCTTGGCGAAAGAGGAAGTATTTGGGCCAGTCGCCCCTCTTTTGAAGTTCAAAACAGACGAAGAAGCA
ATCCAAATGGCTAACGACACCAATGCTGGTTTAGCTGCTTATATATTCTCAACAAACATCAAAAGAGCTTGGCGTGTTACTGAAGCTCTC
GAATATGGAATTGTCGGAGTTAATGAAGGACTAGTTTCAACCGAGGTAGCTCCATTCGGAGGCGTGAAACAATCAGGTCTTGGCCGCGAA
GGTTCTAAATACGGGATGGATGAATATTTAGAGATGAAATATGTGTGCTTGGGGAGTATGAGCTAA\
Edits in Original Sequence 
(5')XXCTCTTTTAGGGTTCCATCXGCTCACACACTCTCTTCACTCTCCGGTAGATCTCCAAATTCTCCGACGGAAAAGTTTATTCATTT
GGATGCTXTGAAGTTGGAATTCGGGTGCCCTGATGCAAATGATTCGTGTGCGTACCAGAATGGCTCTTTCTGCTTGTGCGATGTTACATC
GTTCCTCAATTTCAGGTCCTGTGCGACTGATGACgACAGACACACAAAGTATTGCTGCTAAGCTGAGCAGCTCTGGATTGTTGCGGAGTC
AGGCTCTTATTGGAGGGAAATGGGTTGATGCATATGATGGGAAGACTATAAAGGTCCACAATCCTGCAACAGGGGAGGTAATAACAGATG
TGCCATGCATGGGAGGGAGGGAGACGAACGATGCAATTTCTTCTGCCTATGATGCATTTAGTTCATGGAGCAAACTTACTGCCGCTGAAA
GGAGCAAATATTTAAGGAAGTGGTATGATTTGATAATGGCCCATAAAGAAGAACTTGGACAGCTTATGACACTAGAGCAAGGGAAACCTC
TGAAAGAGGCCATTGGTGAAGTTAGTTATGGGGCTGGTTTTATTGAGTTCTCCGCTGAAGAGGGTAAGCGTATATATGGTGACATCATTC
CATCACCATTAGCAGATAGGCGGTTATTTGTTTTAAAGCAACCAGTTGGTGTTGTTGGTGCAATTACTCCGTGGAATTTTCCCCTGGCTA
TGATTACCCGAAAAGTTGGCCCTGCTCTTGCTTGTGGTTGTACAGTGGTGATAAAACCATCTGAACTCACACCCTTGACTGCTTTAGCAG
CAGCTGAACTCTCCATTCAAGCTGGAATACCACCGGGCGTAGTGAATGTTGTTATGGGAAATGCACCTGCTATTGGAGACGCACTGCTTG
CAAGCCCACAGGTAAGAAAAATTACATTCACAGGTTCAACCAAGGTTGGGAAAAAATTGATGGAAGGTGCTGCTGCCACTGTTAAAAAGG
TATCTCTTGAGCTAGGCGGTAATGCACCTTGCATCATCTTTGATGACGCAGATCTTGAAGTAGCTTTAAAAGGAGCTCTGGCAACAAAGT
TCCGTAACACCGGACAAACATGTGTATGCGCGAACAGAATACTTGTGCAAGAAGGGATATATGATAAATTCGCAAATGCTTTTGCAAAAG
CTGTCCAAAACATGAAAGTTGGAGATGGTTTCACTGAAGGTGTGGAGCAAGGCCCTCTAATCAATGAAGCAGCAGTACAGAAGGTTGAAT
CTTTTGTAGAAGAAGCTACTTCAAAGGGAGCCAAAGTCCTCGTTGGTGGGAAGAGACACAGCCTTGGCATGACTTTCTACGAGCCTACAG
TCGTAACTGGAGTTAACAGTGAGATGCTCTTGGCGAAAGAGGAAGTATTTGGGCCAGTCGCCCCTCTTTTGAAGTTCAAAACAGACGAAG
AAGCAATCCAAATGGCTAACGACACCAATGCTGGTTTAGCTGCTTATATATTCTCAACAAACATCAAAAGAGCTTGGCGTGTTACTGAAG
CTCTCGAATATGGAATTGTCGGAGTTAATGAAGGACTAGTTTCAACCGAGGTAGCTCCATTCGGAGGCGTGAAACAATCAGGTCTTGGCC
GCGAAGGTTCTAAATACGGGATGGATGAATATTTAGAGATGAAATATGTGTGCTTGGGGAGTATGAGCTAA\(3')ATCACCTGTGTAAT
TTTTTTTTTCTCACTAATAAGGGACACAATGGTGCCAGTCTCATTTTGGGTTTAATGCAGTTTTCACGTCTTTATGAATGAACACATTTT
TAGTGTCTTTATTGCCTCTCTTCTTTACAAAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan