ESTScan Details for Unigene SGN-U269621

Score 
258
Direction 
Forward
Predicted Peptide Sequence 
DRFSIQLFSFSKPGHFIKAPKELVDEEHPLLFKPFEMVGLSEYVTSQAGYAAPSDAFKAYCGL
Predicted Coding Sequence 
GATAGATTCTCAATTCAATTATTTTCATTCTCAAAACCAGGTCACTTTATAAAGGCCCCAAAAGAACTTGTGGATGAAGAACACCCTTTA
CTCTTCAAACCATTTGAAATGGTTGGATTATCTGAGTATGTTACTTCCCAAGCTGGCTATGCAGCTCCCAGTGATGCTTTCAAGGCTTAT
TGTGGTCTTTGA\
Edits in Original Sequence 
(5')GATAGATTCTCAATTCAATTATTTTCATTCTCAAAACCAGGTCACTTTATAAAGGCCCCAAAAGAACTTGTGGATGAAGAACACCC
TTTACTCTTCAAACCATTTGAAATGGTTGGATTATCTGAGTATGTTACTTCCCAAGCTGGCTATGCAGCTCCCAGTGATGCTTTCAAGGC
TTATTGTGGTCTTTGA\(3')TATGGTAAACGTGAATTTCTAATGAACGTTTTTGTCAGAGTAGTACTATTAGTATATATGGGATTTCTG
ACAGAATATTCATCAAAAATGTCTTCATCATTTCCAATGGATTTCATTTGGAATTCGTGTTTTTATAATAGAGTGTATCTTTAGCTTTAG
AGTTCTTTGTTTCATATATGCTAGAATAAAAAAACGTGAATTTTTTATGAACGTTCTTGTTAGAATACCGTAAGTATATATGGGATTTCT
AACAGAATGTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan