ESTScan Details for Unigene SGN-U269991

Score 
359
Direction 
Forward
Predicted Peptide Sequence 
MYKELAAVVLLPQGLISTRTFRTCPVCRKLSYFVIPSVIWFSTKEEKQIILDSYKAKLRSIDCKHYALAMGLAHLEIVVSTSFYRVNRYL
WAGLGRVVELXPKHTELQVLSEPLTTLLTREILYKRFKKSKNFELVFLSDKRELRGGKHPPPPTLRLLVRVTKEQKKVGVPKXEHQYRDG
RLEEVVPRDLGHENGSTVIAKNIRLSXLTWQFEKKVSCEYAYSDFRG
Predicted Coding Sequence 
ATGTATAAGGAATTGGCXGCAGTGGTACTCCTTCCACAGGGGTTGATATCAACTCGCACATTTAGGACCTGCCCTGTATGCCGGAAGCTT
TCATATTTTGTCATTCCAAGTGTCATTTGGTTCTCCACAAAAGAAGAAAAGCAAATTATCCTTGACAGCTACAAAGCCAAACTCAGGTCT
ATTGATTGCAAGCATTATGCTTTGGCAATGGGACTTGCCCATTTGGAAATAGTTGTTTCTACAAGTTTCTATAGAGTTAACCGATACTTG
TGGGCGGGACTTGGGAGAGTAGTTGAGCTGCXGCCAAAGCACACCGAGCTTCAGGTATTAAGTGAGCCTTTAACAACATTGTTGACCAGG
GAAATTTTATACAAGAGATTCAAAAAATCCAAAAATTTTGAACTTGTATTTCTCTCTGACAAGAGGGAGTTGCGAGGTGGTAAGCACCCT
CCACCTCCAACCCTAAGGTTGTTGGTTCGAGTCACCAAGGAGCAAAAAAAGGTGGGAGTTCCTAAAGAXGAGCATCAATACCGTGATGGC
CGTCTGGAGGAAGTGGTACCGCGTGATCTTGGTCATGAAAATGGAAGCACAGTGATTGCTAAAAATATTAGGCTCTCAGXACTTACTTGG
CAATTTGAGAAGAAGGTGAGCTGTGAATATGCTTATAGTGATTTCAGGGGTTGA\
Edits in Original Sequence 
GGAAGTCGGGATCCTTTTCGAGTGTGATCATCCATTTTGTATATC(5')ATGTATAAGGAATTGGCXGCAGTGGTACTCCTTCCACAGGG
GTTGATATCAACTCGCACATTTAGGACCTGCCCTGTATGCCGGAAGCTTTCATATTTTGTCATTCCAAGTGTCATTTGGTTCTCCACAAA
AGAAGAAAAGCAAATTATCCTTGACAGCTACAAAGCCAAACTCAGGTCTATTGATTGCAAGCATTATGaCTTTGGCAATGGGACTTGCCC
ATTTGGAAATAGTTGTTTCTACAAGTTTCTATAGAGTTAACCGATACTTGTGGGCGGGACTTGGGAGAGTAGTTGAGCTGCXGCCAAAGC
ACACCGAGCTTCAGGTATTAAGTGAGCCTTTAACAACATTGTTGACCAGGGAAATTTTATACAAGAGATTCAAAAAATCCAAAAATTTTG
AACTTGTATTTCTCTCTGACAAGAGGGAGTTGCtGAGGTGGTAAGCACCCTCCACCTCCAACCCTAAGGTTGTTGGTTCGAGTCACCAAG
GAGCAAAAAAAGGTGGGAGTTCCTAAAGAXGAGCATCAATACCGTGATGGCCGTCTGGAGGAAGTGGTACCGCGTGATCTTGGTCATGAA
AATGGAAGCACAGTGATTGCTAAAAATATTAGGCTCTCAGXACTTACTTGGCAATTTGAGAAGAAGGTGAGCTGTGAATATGCTTATAGT
GATTTCAGGGGTTGA\(3')AGTCGGAAACAAGTTACATTTCTTCTAAGTGGTTACAAGATTTATTGAATCATGTGAGTACTGGTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan