ESTScan Details for Unigene SGN-U269993

Score 
544
Direction 
Forward
Predicted Peptide Sequence 
VSSGIEPPKAKALASFNEPEXRERIALFSLWLFNSSTIAKFMVPCHVEKDSLQVLCKWCMSXKESTVSSRMIGKILQIMYAHTTKKDYVP
MAAGXRYKHVKVSEQPSLPSSSAPAQHLLSASPPTTLSPGMLANGAGLLSGISSASGRSFYPPNQPVWSENSEHHDAAVIDNIVELKRMN
PADRSICSFAAAGNVHGEKTVLIFMEIYVQYVRRIACIPFXPLEREEHIKICEKRQKRLELLKHSQEIECSVCLERVLSKTTAAERKFGI
LFECDHPFCISCIRNWRSGTPSSGVDINSTFRTCPVCRKLSYFVIPSVIWFSTKEEKQIILDSYKAKLRSIDCKHYDFGNGTCPFGNSCF
YKHQYRDGRLEEVVPRDLGHENGSTVIAKNIRLSXLAWQFEKKVSCEYAYSDFXGLKSETTYISSKWLQDLLNYVSTGEFALGVEVQHGI
PDTRDLLV
Predicted Coding Sequence 
XXAGTTAGTAGTGGGATCGAACCGCCAAAAGCAAAAGCCCTAGCCTCCTTTAACGAGCCAGAGXCGAGGGAGCGAATCGCTCTATTCTCG
CTCTGGCTGTTCAATTCATCAACAATTGCCAAGTTCATGGTTCCATGTCATGTCGAAAAGGATTCTTTGCAAGTTCTTTGTAAATGGTGC
ATGTCTGAXAAGGAGAGTACTGTGAGTTCTCGCATGATTGGAAAGATCCTCCAAATAATGTATGCACATACTACCAAAAAGGATTATGTG
CCTATGGCAGCAGGTGXTAGATACAAACATGTTAAAGTTTCTGAACAACCCTCACTTCCATCTTCGTCAGCTCCAGCTCAACATCTGCTC
TCAGCTTCTCCTCCCACCACCCTCTCTCCTGGAATGCTAGCAAATGGTGCAGGACTTCTTTCAGGCATTTCTTCCGCGTCAGGCAGATCT
TTTTACCCTCCCAACCAGCCTGTATGGAGTGAAAATTCAGAGCATCATGATGCGGCAGTTATTGATAATATTGTCGAGTTAAAGAGAATG
AATCCAGCTGATCGATCAATTTGCTCTTTTGCTGCTGCTGGAAATGTCCACGGGGAGAAAACTGTCCTTATATTCATGGAGATTTATGTC
CAATATGTGCGAAGAATTGCTTGCATCCCTTTCXGGCCTCTTGAAAGAGAGGAGCATATAAAAATATGTGAGAAGAGGCAAAAGCGCCTT
GAGTTACTGAAGCATAGTCAAGAAATAGAGTGCAGTGTATGTCTTGAACGTGTACTCTCTAAGACAACTGCAGCAGAGCGGAAGTTCGGG
ATCCTTTTTGAGTGTGATCATCCATTTTGTATATCATGTATAAGGAATTGGCGCAGTGGTACTCCTTCCTCTGGGGTTGATATCAACTCG
ACATTTAGGACCTGCCCTGTATGCCGGAAGCTTTCATATTTTGTCATTCCAAGTGTCATTTGGTTCTCCACAAAAGAAGAAAAGCAAATT
ATCCTTGACAGCTACAAAGCCAAACTCAGGTCTATTGATTGCAAGCATTATGACTTTGGCAATGGGACTTGCCCATTTGGAAATAGTTGT
TTCTACAAGCATCAATACCGTGATGGCCGTCTGGAGGAAGTGGTACCGCGTGATCTTGGTCATGAAAATGGAAGCACAGTGATTGCTAAA
AATATTAGGCTCTCAGXACTTGCTTGGCAATTTGAGAAGAAGGTGAGCTGTGAATATGCTTATAGTGATTTCAXGGGGTTGAAGTCGGAA
ACAACTTACATTTCTTCTAAGTGGTTACAAGATTTATTGAATTATGTGAGTACTGGTGAATTTGCGTTGGGAGTTGAGGTGCAACATGGC
ATTCCAGACACAAGGGACTTGCTTGTATAA\
Edits in Original Sequence 
(5')XXAGTTAGTAGTGGGATCGAACCGCCAAAAGCAAAAGCCCTAGCCTCCTTTAACGAGCCAGAGXCGAGGGAGCGAATCGCTCTATT
CTCGCTCTGGCTGTTCAATTCATCAACAATTGCCAAGTTCATGGTTCCATGTCATGTCGAAAAGGATTCTTTGCAAGTTCTTTGTAAATG
GTGCATGTCTGAXAAGGAGAGTACTGTGAGTTCTCGCATGATTGGAAAGATCCTCCAAATAATGTATGCACATACTACCAAAAAGGATTA
TGTGCCTATGGCAGCAGGTGXTAGATACAAACATGTTAAAGTTTCTGAACAACCCTCACTTCCATCTTCGTCAGCTCCAGCTCAACATCT
GCTCTCAGCTTCTCCTCCCACCACCCTCTCTCCTGGAATGCTAGCAAATGGTGCAGGACTTCTTTCAGGCATTTCTTCCGCGTCAGGCAG
ATCTTTTTACCCTCCCAACCAGCCTGTATGGAGTGAAAATTCAGAGCATCATGATGCGGCAGTTATTGATAATATTGTCGAGTTAAAGAG
AATGAATCCAGCTGATCGATCAATTTGCTCTTTTGCTGCTGCTGGtAAATGTCCACGGGGAGAAAACTGTCCTTATATTCATGGAGATTT
ATGTCCAATATGTGCGAAGAATTGCTTGCATCCCTTTCXGGCCTCTTGAAAGAGAGGAGCATATAAAAATATGTGAGAAGAGGCAAAAGC
GCCTTGAGTTACTGAAGCATAGTCAAGAAATAGAGTGCAGTGTATGTCTTGAACGTGTACTCTCTAAGACAACTGCAGCAGAGCGGAAGT
TCGGGATCCTTTTTGAGTGTGATCATCCATTTTGTATATCATGTATAAGGAATTGGCGCAGTGGTACTCCTTCCTCTGGGGTTGATATCA
ACTCGACATTTAGGACCTGCCCTGTATGCCGGAAGCTTTCATATTTTGTCATTCCAAGTGTCATTTGGTTCTCCACAAAAGAAGAAAAGC
AAATTATCCTTGACAGCTACAAAGCCAAACTCAGGTCTATTGATTGCAAGCATTATGACTTTGGCAATGGGACTTGCCCATTTGGAAATA
GTTGTTTCTACAAGCATCAATACCGTGATGGCCGTCTGGAGGAAGTGGTACCGCGTGATCTTGGTCATGAAAATGGAAGCACAGTGATTG
CTAAAAATATTAGGCTCTCAGXACTTGCTTGGCAATTTGAGAAGAAGGTGAGCTGTGAATATGCTTATAGTGATTTCAXGGGGTTGAAGT
CGGAAACAACTTACATTTCTTCTAAGTGGTTACAAGATTTATTGAATTATGTGAGTACTGGTGAATTaTGCGTTGGGAGTTGAGGTGCAg
ACATGGCATTCCAGACACAAGGGACTTGCTTGTATAA\(3')TCATGGATACATGTGTATGGAACTTAACCTATCCCCTAAATAAAAAAA
TAAAAAAAAAAAAAAAAAACTCGAGACTAGTTCTCTCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan