Notice: If you try to use Google Chrome to access the SGN FTP site, please check this link to resolve connection issues.

ESTScan Details for Unigene SGN-U270017

Score 
631
Direction 
Forward
Predicted Peptide Sequence 
TKAKAFTFSPLHFIMSQTVVLKVGMSCQGCVGAVNRVLGKMEGVESFDIDIKEQKVTVKGNVEPEAVFQTVSKTGKKTSFWEAPAPAPAP
APTPAEPETKPVEEKPTETPAEPEPKPAEEKPAETVVAPA
Predicted Coding Sequence 
XXCACCAAAGCAAAAGCTTTCACATTTTCCCCTCTACATTTCATCATGTCTCAGACAGTTGTTCTCAAGGTTGGTATGTCATGCCAAGGC
TGTGTTGGAGCTGTCAACAGAGTTTTGGGCAAAATGGAAGGTGTTGAATCATTTGACATCGATATAAAAGAGCAAAAAGTGACAGTAAAA
GGAAATGTGGAACCAGAAGCTGTTTTCCAGACTGTTTCAAAGACCGGAAAGAAGACTTCGTTTTGGGAAGCACCAGCACCAGCACCAGCA
CCAGCACCAACACCAGCTGAACCCGAAACAAAGCCCGTAGAAGAAAAGCCCACAGAAACACCAGCTGAGCCCGAACCAAAGCCCGCGGAA
GAAAAGCCTGCAGAAACTGTCGTTGCTCCAGCATGA\
Edits in Original Sequence 
(5')XXCACCAAAGCAAAAGCTTTCACATTTTCCCCTCTACATTTCATCATGTCTCAGACAGTTGTTCTCAAGGTTGGTATGTCATGCCA
AGGCTGTGTTGGAGCTGTCAACAGAGTTTTGGGCAAAATGGAAGGTGTTGAATCATTTGACATCGATATAAAAGAGCAAAAAGTGACAGT
AAAAGGAAATGTGGAACCAGAAGCTGTTTTCCAGACTGTTTCAAAGACCGGAAAGAAGACTTCGTTTTGGGAAGCACCAGCACCAGCACC
AGCACCAGCACCAACACCAGCTGAACCCGAAACAAAGCCCGTAGAAGAAAAGCCCACAGAAACACCAGCTGAGCCCGAACCAAAGCCCGC
GGAAGAAAAGCCTGCAGAAACTGTCGTTGCTCCAGCATGA\(3')TGATGATATAAGCTTAATTAATGGGCTGAAAATTTATACCATATG
CTTGTGATTTATTATGCAACTTTCCTTTTATGACTAAAGCCAGAATGTGATCTTAATGAGAGCTGAAATAATTGTCTTGTTTGGTTTTCT
TGTAATGTTGATAGTAAGTTTTGCTATCAAATCATGTATCTTGTATTTTAATTTGTGCATGTTTTGGATCATCAAAAAGATTACAATTTT
GAAAATAGTTGGAAATA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan