ESTScan Details for Unigene SGN-U270018

Score 
553
Direction 
Forward
Predicted Peptide Sequence 
MSQTVVLKVGMSCQGCVGAVNRVLGKMEGVESFDIDIKEQKVTVKGNVEPDAVFQTVSKTGKKTSFWEAPAPAPAPAPTPAEPETKPVEE
KPTETPAEPEPKPAEEKPAETVAPADDDIA
Predicted Coding Sequence 
ATGTCTCAGACAGTTGTTCTCAAGGTTGGTATGTCATGCCAAGGCTGTGTTGGAGCTGTCAACAGAGTTTTGGGCAAAATGGAAGGTGTT
GAATCATTTGACATCGATATAAAGGAGCAAAAAGTGACCGTAAAAGGAAATGTGGAACCAGACGCTGTTTTCCAGACTGTTTCAAAGACT
GGAAAGAAGACTTCGTTTTGGGAAGCACCAGCACCAGCACCAGCACCAGCACCAACACCAGCTGAACCCGAAACAAAGCCCGTAGAAGAA
AAGCCCACAGAAACACCAGCTGAGCCCGAACCAAAGCCCGCGGAAGAAAAGCCCGCAGAAACTGTTGCTCCAGCTGATGATGATATAGCT
TAA\
Edits in Original Sequence 
TACATAATTTCTTCTCACTAAAGCAAAAGCTTTCACATTTTTTCCCCTACATTTCATC(5')ATGTCTCAGACAGTTGTTCTCAAGGTTG
GTATGTCATGCCAAGGCTGTGTTGGAGCTGTCAACAGAGTTTTGGGCAAAATGGAAGGTGTTGAATCATTTGACATCGATATAAAGGAGC
AAAAAGTGACCGTAAAAGGAAATGTGGAACCAGACGCTGTTTTCCAGACTGTTTCAAAGACTGGAAAGAAGACTTCGTTTTGGGAAGCAC
CAGCACCAGCACCAGCACCAGCACCAACACCAGCTGAACCCGAAACAAAGCCCGTAGAAGAAAAGCCCACAGAAACACCAGCTGAGCCCG
AACCAAAGCCCGCGGAAGAAAAGCCCGCAGAAACTGTTGCTCCAGCaTGATGATGATATAGCTTAA\(3')TTAATGGGCTGAAAATTTA
TACCATATGCTTGTGATTTATACTAAAGCCAGAATGTGATCTTAATGAGTGCTGAAATAATTGTCTTGCTAATTTTCTGTGTTTGGTTTT
CTTGTAATGTTGATAGTAAGTTTTGCTATCAAATCATGTATCTTGTATTTTAATTTGTGCATGTTTTGGATCATCAAAAAGATTACAATT
TGAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan