ESTScan Details for Unigene SGN-U270025

Score 
1738
Direction 
Forward
Predicted Peptide Sequence 
MGEEEKKVEEVKKEEAPKDEKPSDGGGGEEKKEEKKAEEESKEAKPEPPPPPPEIVLRVFMHCEGCARKVRKSLKGFQGVEDVLTDCKTH
KVVVKGEKADPLKVLERIQKKSHRQVELLSPIPKPPAAAAAEEPKKPEEKEAVKAEEKKEEPQVITVVLKVHMHCEACAQEIKRRIQKMK
GVENAEPDLKNSQVTVKGVFEATKLVEYVSKRTGKRAVIVKVEPEQKAKEEAKPKEDQKEEKKTDDKEAKKVEEGDNKEEKKEEAAAPAK
EEAVVAAAPAKEEAVQNDVDPIVDVKKNEFYYYHHPQNHQLYNNPQRLAHEMFAYPPPPQIFSDENPNAXFRDEIWRDVRGKKGNVRPTP
LVLRGSLHVRLCLGTR
Predicted Coding Sequence 
ATGGGAGAGGAAGAGAAGAAGGTAGAAGAAGTGAAGAAAGAGGAGGCACCGAAAGATGAAAAGCCAAGCGACGGCGGTGGTGGTGAAGAG
AAGAAAGAGGAAAAAAAGGCGGAGGAAGAATCAAAAGAGGCGAAACCAGAACCTCCACCTCCACCACCGGAAATTGTTTTGAGAGTTTTC
ATGCATTGTGAAGGTTGTGCTCGTAAAGTCCGCAAATCGCTCAAAGGATTCCAAGGAGTTGAAGATGTGTTGACGGATTGCAAAACTCAC
AAGGTTGTAGTGAAAGGGGAAAAAGCAGATCCGTTGAAGGTATTGGAGAGAATACAGAAAAAGAGTCATCGTCAAGTTGAGCTTCTCTCT
CCAATCCCAAAACCACCGGCGGCGGCGGCGGCCGAAGAGCCCAAGAAACCGGAGGAAAAAGAAGCCGTTAAAGCCGAAGAGAAAAAAGAG
GAGCCTCAGGTGATTACAGTAGTTCTGAAAGTTCACATGCATTGTGAGGCTTGTGCACAAGAAATCAAAAGACGTATACAGAAAATGAAA
GGTGTGGAGAATGCAGAACCGGACTTGAAAAACTCACAAGTGACAGTGAAAGGTGTGTTTGAGGCAACAAAACTGGTGGAATATGTAAGC
AAAAGGACTGGAAAACGGGCAGTTATTGTGAAAGTAGAACCTGAACAGAAAGCGAAGGAGGAGGCTAAGCCCAAAGAAGATCAAAAGGAA
GAGAAGAAAACCGATGACAAAGAAGCGAAGAAAGTTGAAGAAGGTGACAACAAAGAGGAGAAGAAGGAAGAAGCAGCCGCACCAGCTAAG
GAAGAAGCCGTAGTAGCAGCTGCACCAGCTAAGGAAGAAGCTGTACAAAACGACGTCGATCCAATAGTAGATGTGAAGAAGAATGAGTTT
TACTACTATCACCATCCTCAGAATCATCAGCTGTATAATAATCCACAGAGGCTTGCACATGAAATGTTTGCGTACCCTCCACCTCCGCAG
ATTTTCAGCGATGAAAATCCGAATGCAXTGTTCCGTGATGAAATTTGGAGGGACGTGAGGGGTAAAAAGGGAAATGTACGTCCAACCCCT
CTTGTGCTGCGTGGTTCTCTTCATGTGAGGCTTTGTCTTGGGACTCGCTAA\
Edits in Original Sequence 
AGTGAGTGCTCTTTCTCCCTTAGATCTGATGCTCCATCACTAGCCTACTTCCCCACACTTTTTCTTTTCTCCATAAAAAGAGAAGAGAGA
GAAAAAACCAAACCTGTAACAGCTACATTTCCATTTCTGTTTAACA
(5')ATGGGAGAGGAAGAGAAGAAGGTAGAAGAAGTGAAGAAAG
AGGAGGCACCGAAAGATGAAAAGCCAAGCGACGGCGGTGGTGGTGAAGAGAAGAAAGAGGAAAAAAAGGCGGAGGAAGAATCAAAAGAGG
CGAAACCAGAACCTCCACCTCCACCACCGGAAATTGTTTTGAGAGTTTTCATGCATTGTGAAGGTTGTGCTCGTAAAGTCCGCAAATCGC
TCAAAGGATTCCAAGGAGTTGAAGATGTGTTGACGGATTGCAAAACTCACAAGGTTGTAGTGAAAGGGGAAAAAGCAGATCCGTTGAAGG
TATTGGAGAGAATACAGAAAAAGAGTCATCGTCAAGTTGAGCTTCTCTCTCCAATCCCAAAACCACCGGCGGCGGCGGCGGCCGAAGAGC
CCAAGAAACCGGAGGAAAAAGAAGCCGTTAAAGCCGAAGAGAAAAAAGAGGAGCCTCAGGTGATTACAGTAGTTCTGAAAGTTCACATGC
ATTGTGAGGCTTGTGCACAAGAAATCAAAAGACGTATACAGAAAATGAAAGGTGTGGAGAATGCAGAACCGGACTTGAAAAACTCACAAG
TGACAGTGAAAGGTGTGTTTGAGGCAACAAAACTGGTGGAATATGTAAGCAAAAGGACTGGAAAACGGGCAGTTATTGTGAAAGTAGAAC
CTGAACAGAAAGCGAAGGAGGAGGCTAAGCCCAAAGAAGATCAAAAGGAAGAGAAGAAAACCGATGACAAAGAAGCGAAGAAAGTTGAAG
AAGGTGACAACAAAGAGGAGAAGAAGGAAGAAGCAGCCGCACCAGCTAAGGAAGAAGCCGTAGTAGCAGCTGCACCAGCTAAGGAAGAAG
CTGTACAAAACGACGTCGATCCAATAGTAGATGTGAAGAAGAATGAGTTTTACTACTATCACCATCCTCAGAATCATCAGCTGTATAATA
ATCCACAGAGGCTTGCACATGAAATGTTTGCGTACCCTCCACCTCCGCAGATTTTCAGCGATGAAAATCCGAATGCAXTGTTCCGTGATG
tAAATTTGGAGGGACGTGAGGGGTAAAAAGGGAAATGTACGTCCAACCCCTCTTGTGCTGCGTGGTTCTCTTCATGTGAGGCTTTGTCTT
GGGACTCGCTAA\(3')GTTACAAGTGATCTGCTAGACAAATACTGTAGAATTTTGTGAGCCCTTTGTACTTTTTTTATTTGTTTTTGTT
TCCTTTATGTTGTTATATACTCCCTATATGTATGATACAATAAACAGTACTATATGAAAATTTTAAATATCGTACTTGGAAAAAAAAAAA
AAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan