ESTScan Details for Unigene SGN-U270047

Score 
560
Direction 
Forward
Predicted Peptide Sequence 
EWNLDFVENCEQGXIGIXELXSQGFDESPLRISLGLLAGPSQVGNQPLIPLFNKLDFLDHSHECLLLPYEQALTREDSTSGLFYDCSAHM
VWVGERTRQLDGAHVEFLRGVANPLGIKVSQKMDPNELIKLIDILNPANKPGRITVIVRMGAENMRVKLSHLVRAVRGAGQIVTWVCDPM
HGNTIKAPCGLKTRAFDSILAEVRAFFDVHEQEGSHPGGIHLEMTGQNVTECIGGSRTVTYDDLGSRYHTHCDPRLNASQSLELSFIVAE
RQEDEECPLNVCRLI
Predicted Coding Sequence 
XCCGAATGGAATCTTGATTTTGTGGAGAACTGTGAGCAGGGNAXGATAGGTATCANGGAACTANGCTCACAGGGGTTTGATGAAAGCCCT
TTAAGGATTTCATTGGGCTTGCTTGCTGGACCTTCACAGGTTGGAAACCAACCCTTAATTCCATTGTTCAACAAACTTGATTTCCTGGAC
CATTCCCACGAGTGCTTGCTTCTTCCTTATGAACAAGCACTTACAAGGGAGGATTCAACTTCTGGTCTTTTCTATGATTGTTCTGCTCAC
ATGGTATGGGTTGGGGAAAGAACCAGGCAACTAGACGGTGCTCATGTCGAGTTTTTGAGAGGAGTTGCAAACCCTCTTGGCATAAAGGTG
AGTCAAAAAATGGATCCAAATGAGCTAATTAAGCTCATTGACATCCTGAACCCTGCCAATAAGCCTGGAAGAATAACTGTAATTGTTAGA
ATGGGTGCTGAGAACATGAGAGTGAAACTTTCCCACTTGGTCAGGGCAGTACGAGGAGCTGGTCAGATTGTGACATGGGTTTGTGATCCA
ATGCACGGGAATACCATCAAGGCACCATGTGGACTCAAAACCCGTGCTTTCGATTCAATCCTGGCTGAGGTCCGAGCTTTCTTCGATGTG
CATGAGCAAGAAGGAAGCCACCCTGGTGGTATTCACCTAGAAATGACAGGGCAAAATGTGACTGAGTGCATTGGTGGATCACGAACAGTA
ACCTATGACGATTTGGGCTCTCGCTACCACACTCATTGTGACCCAAGATTGAATGCTTCTCAGTCTCTTGAACTTTCCTTCATCGTAGCT
GAGAGACAAGAAGACGAAGAATGTCCACTCAACGTCTGTAGGCTTATCTAA\
Edits in Original Sequence 
(5')XCCGAATGGAATCTTGATTTTGTGGAGAACTGTGAGCAGGGNAXGATAGGTATCANGGAACTANGCTCACAGGGGTTTGATGAAAG
CCCTTTAAGGATTTCATTGGGCTTGCTTGCtTGGACCTTCACAGGTTGGAAACCAACCCTTAATTCCATTGTTCAACAAACTTGATTTCC
TGGACCATTCCCACGAGTGCTTGCTTCTTCCTTATGAACAAGCACTTACAAGGGAGGATTCAACTTCTGGTCTTTTCTATGATTGTTCTG
CTCACATGGTATGGGTTGGGGAAAGAACCAGGCAACTAGACGGTGCTCATGTCGAGTTTTTGAGAGGAGTTGCAAACCCTCTTGGCATAA
AGGTGAGTCAAAAAATGGATCCAAATGAGCTAATTAAGCTCATTGACATCCTGAACCCTGCCAATAAGCCTGGAAGAATAACTGTAATTG
TTAGAATGGGTGCTGAGAACATGAGAGTGAAACTTTCCCACTTGGTCAGGGCAGTACGAGGAGCTGGTCAGATTGTGACATGGGTTTGTG
ATCCAATGCACGGGAATACCATCAAGGCACCATGTGGACTCAAAACCCGTGCTTTCGATTCAATCCTGGCTGAGGTCCGAGCTTTCTTCG
ATGTGCATGAGCAAGAAGGAAGCCACCCTGGTGGTATTCACCTAGAAATGACAGGGCAAAATGTGACTGAGTGCATTGGTGGATCACGAA
CAGTAACCTATGACGATTTGGGCTCTCGCTACCACACTCATTGTGACCCAAGATTGAATGCTTCTCAGTCTCTTGAACTTTCCTTCATCG
TAGCTGAGAGACtAAGAAGACGAAGAATGTCCACTCAACGTCTGTAGGCTTATCTAA\(3')TTTACCTGTACTTTTTTAGTATGGATTC
TTGTTCTCTTGGTATCCAATAACTTATATATGTGGCCTCTGGCCATTTGAGCTGCTGTTTGGATCCAATGTTGAACATGTTACTAATAAA
CATGGCAGAGCAACTTGCCTATGAGGTAAATAGGTTTCCTGCAGAGATCAAAGGGGAAATGAACATCAAGTAATTAGTCGATTTATCCGG
TATCTGTTCTGTTTATTTTAGTTTGGACTGTAAGTCTAGGGTATAAGGGTGTTCTTTTTCTTTCCTTGATGTATGAATGATACTTTGAGA
TACTGGTTTTGCTGTTTTAGTCTAATGTGTTTGCCTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan