ESTScan Details for Unigene SGN-U270085

Score 
1495
Direction 
Forward
Predicted Peptide Sequence 
MTSFTKKEYEFLKELGIGPQNLGCYVNGTWKATGPVISTVNPANNQIIAEVVEASAQDYEEGMSACAEAAKIWVQVPAPKRGEIVRQIGD
ALRANLQEFGRLVSLEMGKILPEGIGEVQEVIDMCDFAVGLSRQLNGSVIPSERPNHMMLEMWNPLGIVGVITAFNFPCAVLGWNACIAL
VCGNCVVWKGAPTTPLVTIAMTKIVASVLEKNNLPGSIFTAFCGGADVGQTIAKDTRIPLVSFTGSSKVGLAVQQTVSQRFGKCLLELSG
NNAIIIMDDADIKLAVRSVLFAAVGTAGXALYNMPETACAESIYEKVLEPLVDVYKQVKIGDPLEKGTLLGPLHTRTSRENFEKGIHNIK
SQGGKILTGGSVVESEGNFVHPTIVEISSKAEIVKEELFAPVLYVMKFKTFEEAVEINNSVPQGLSSSIFTRNPENIFKWIGPQGSDCGI
VNVNIPTNGAEIGGAFGGEKGTGGGREAGSDSWKQYMRRSTCTINYGNELPLAQGINFGLVEIGADTPVSLVNSSCKVLMIAPESLK
Predicted Coding Sequence 
ATGACTAGTTTCACGAAGAAAGAGTACGAATTCCTCAAAGAGCTCGGAATTGGCCCTCAAAATCTCGGTTGTTATGTTAATGGCACCTGG
AAAGCTACTGGCCCCGTCATTTCCACTGTTAATCCTGCTAACAACCAGATCATTGCCGAAGTTGTCGAAGCTTCTGCTCAAGATTATGAG
GAAGGCATGTCAGCTTGCGCTGAAGCAGCTAAGATTTGGGTGCAGGTTCCTGCACCAAAAAGAGGTGAGATTGTTAGACAGATAGGTGAT
GCACTCCGAGCGAACCTTCAGGAATTTGGTCGACTTGTTTCACTTGAAATGGGAAAGATACTCCCAGAAGGAATTGGGGAGGTTCAAGAA
GTCATTGATATGTGTGATTTTGCTGTGGGATTGAGTCGACAACTGAATGGATCCGTTATTCCTTCTGAACGTCCTAACCACATGATGTTG
GAGATGTGGAATCCTCTCGGGATAGTTGGTGTAATCACAGCTTTCAACTTCCCATGTGCTGTACTTGGATGGAATGCATGTATCGCACTG
GTCTGTGGCAATTGTGTTGTCTGGAAAGGTGCTCCAACAACACCATTGGTTACCATTGCGATGACAAAAATTGTGGCTAGTGTATTGGAG
AAAAACAATTTACCTGGTTCAATTTTTACTGCCTTCTGCGGTGGAGCTGATGTTGGTCAAACAATAGCAAAGGACACACGAATTCCTCTA
GTTTCATTCACTGGGAGTTCAAAGGTTGGTCTTGCAGTTCAGCAAACAGTAAGTCAGAGATTTGGAAAATGTCTATTAGAACTAAGTGGA
AATAATGCCATCATAATAATGGATGATGCGGACATTAAACTTGCTGTTCGCTCTGTTTTATTTGCTGCTGTTGGTACGGCTGGTCAXGCG
CTGTACAACATGCCGGAGACTGCTTGTGCAGAATCAATATATGAGAAGGTACTTGAACCACTAGTTGATGTTTACAAGCAAGTTAAGATA
GGGGATCCTTTAGAAAAAGGTACCTTACTTGGGCCATTGCATACTCGTACTTCTAGGGAAAATTTCGAGAAGGGAATCCACAATATCAAG
TCCCAGGGTGGAAAGATCCTTACAGGTGGTTCAGTCGTAGAATCTGAGGGTAATTTTGTGCATCCAACAATTGTTGAAATTTCTTCAAAA
GCTGAAATTGTGAAGGAAGAACTGTTTGCTCCAGTTCTGTATGTAATGAAGTTTAAGACTTTCGAAGAAGCAGTTGAAATCAACAACTCT
GTCCCTCAAGGTTTAAGTAGTTCCATCTTCACCCGAAATCCAGAAAATATATTTAAGTGGATTGGACCTCAAGGAAGTGATTGTGGCATC
GTCAATGTGAATATCCCAACAAATGGAGCTGAAATTGGCGGTGCTTTTGGAGGTGAGAAAGGTACTGGTGGTGGCCGTGAGGCAGGAAGT
GATTCTTGGAAACAATACATGAGACGCTCAACTTGTACAATCAACTATGGGAATGAATTACCATTGGCTCAAGGAATCAATTTTGGXCTA
GTTGAAATTGGTGCAGATACGCCCGTTTCGCTCGTGAATTCATCCTGTAAGGTGCTTATGATTGCCCCGGAATCACTTAAATAA\
Edits in Original Sequence 
CGTCTCTTCTACTACTATATACTACTATTTCTTCCAGTGGGTTGGATCGCCACTTCTATCGCATTTCATTATTTCTTCATTCTGTATCTA
TTCCTCCATTGTGTGAAATC
(5')ATGACTAGTTTCACGAAGAAAGAGTACGAATTCCTCAAAGAGCTCGGAATTGGCCCTCAAAATCTC
GGTTGTTATGTTAATGGCACCTGGAAAGCTACTGGCCCCGTCATTTCCACTGTTAATCCTGCTAACAACCAGATCATTGCCGAAGTTGTC
GAAGCTTCTGCTCAAGATTATGAGGAAGGCATGTCAGCTTGCGCTGAAGCAGCTAAGATTTGGGTGCAGGTTCCTGCACCAAAAAGAGGT
GAGATTGTTAGACAGATAGGTGATGCACTCCGAGCGAACCTTCAGGAATTTGGTCGACTTGTTTCACTTGAAATGGGAAAGATACTCCCA
GAAGGAATTGGGGAGGTTCAAGAAGTCATTGATATGTGTGATTTTGCTGTGGGATTGAGTCGACAACTGAATGGATCCGTTATTCCTTCT
GAACGTCCTAACCACATGATGTTGGAGATGTGGAATCCTCTCGGGATAGTTGGTGTAATCACAGCTTTCAACTTCCCATGTGCTGTACTT
GGATGGAATGCATGTATCGCACTGGTCTGTGGCAATTGTGTTGTCTGGAAAGGTGCTCCAACAACACCATTGGTTACCATTGCGATGACA
AAAATTGTGGCTAGTGTATTGGAGAAAAACAATTTACCTGGTTCAATTTTTACTGCCTTCTGCGGTGGAGCTGATGTTGGTCAAACAATA
GCAAAGGACACACGAATTCCTCTAGTTTCATTCACTGGGAGTTCAAAGGTTGGTCTTGCAGTTCAGCAAACAGTAAGTCAGAGATTTGGA
AAATGTCTATTAGAACTAAGTGGAAATAATGCCATCATAATAATGGATGATGCGGACATTAAACTTGCTGTTCGCTCTGTTTTATTTGCT
GCTGTTGGTACGGCTGGTCAXGCGCTGTACAACATGCCGGAGACTGCTTGTGCAcGAATCAATATATGAGAAGGTACTTGAACCACTAGT
TGATGTTTACAAGCAAGTTAAGATAGGGGATCCTTTAGAAAAAGGTACCTTACTTGGGCCATTGCATACTCGTACTTCTAGGGAAAATTT
CGAGAAGGGAATCCACAATATCAAGTCCCAGGGTGGAAAGATCCTTACAGGTGGTTCAGTCGTAGAATCTGAGGGTAATTTTGTGCATCC
AACAATTGTTGAAATTTCTTCAAAAGCTGAAATTGTGAAGGAAGAACTGTTTGCTCCAGTTCTGTATGTAATGAAGTTTAAGACTTTCGA
AGAAGCAGTTGAAATCAACAACTCTGTCCCTCAAGGTTTAAGTAGTTCCATCTTCACCCGAAATCCAGAAAATATATTTAAGTGGATTGG
ACCTCAAGGAAGTGATTGTGGCATCGTCAATGTGAATATCCCAACAAATGGAGCTGAAATTGGCGGTGCTTTTGGAGGTGAGAAAGGTAC
TGGTGGTGGCCGTGAGGCAGGAAGTGATTCTTGGAAACAATACATGAGACGCTCAACTTGTACAATCAACTATGGGAATGAATTACCATT
GGCTCAAGGAATCAATTTTGGXCTAGTTGAAATTGGTGCAGATACGCCCGTTTCGCTCGTGAATTCATCCTGTAAGGTGCTTATGATTGC
CCCGGAATCACTTAAATAA\(3')TGTACCTTCCTTGCAACTCAATTAAAATAATGTATTCTGAACCTAGTGTTCTCAGTGATCAGTACC
AGGTTGCCTAATCAATGAGTTTACTTGGCCGTTCTACTTTATTTTGAGAGTTGTTAACCTTAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan