ESTScan Details for Unigene SGN-U270106

Score 
567
Direction 
Forward
Predicted Peptide Sequence 
MASDRKLHAFEEVAKHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSATGKDATNDFEDVGHSDSAREMMDKYYIGEIDMSTVPLKRA
SIPSEQTAYNPDKTPEFIXQNPTVPCTHLDLGLGLNSTTLHQGAVILLNSSLSGPLFLIYELLKEHLVNLVLVHYRAATTECGRQFCTVL
YNCYVRCLLAALDLTW
Predicted Coding Sequence 
ATGGCGTCAGATCGGAAACTTCATGCATTTGAGGAGGTCGCTAAGCACAACAAGACCAAAGATTGCTGGCTCATCATCAGCGGAAAGGTG
TATGATGTAACTCCGTTCATGGATGATCATCCAGGTGGTGATGAAGTTTTGCTTTCAGCAACTGGGAAAGATGCAACAAATGACTTTGAA
GATGTTGGCCACAGTGATTCTGCTAGAGAGATGATGGATAAGTATTACATTGGGGAAATTGACATGTCAACAGTTCCCCTAAAACGTGCT
TCTATTCCATCGGAACAAACTGCATACAATCCAGACAAGACTCCAGAATTCATTXATCAAAATCCTACAGTTCCTTGTACCCATCTTGAT
CTTGGGCTTGGCCTTAACAGTACGACACTACACCAAGGAGCAGTAATTCTTCTGAATTCCAGTCTATCAGGCCCTCTTTTCTTGATTTAT
GAGTTGTTGAAAGAACACTTGGTTAATCTTGTTTTAGTTCATTATCGAGCTGCAACAACTGAATGTGGTCGTCAATTTTGTACTGTGCTT
TACAATTGCTATGTCCGATGCCTCTTGGCAGCACTAGACTTGACCTGG\
Edits in Original Sequence 
CAGAGTATGCTCTGTTTTTTCCTCGTGCCGAAATTCGGCACAATCGGAGAGAGAAACAGAATCCAAAGAACTCTCTCTCTGTCTCTTTCT
CTAGCAGGAAAAAA
(5')ATGGCGTCAGATCGGAAACTTCATGCATTTGAGGAGGTCGCTAAGCACAACAAGACCAAAGATTGCTGGCTC
ATCATCAGCGGAAAGGTGTATGATGTAACTCCGTTCATGGATGATCATCCAGGTGGTGATGAAGTTTTGCTTTCAGCAACTGGGAAAGAT
GCAACAAATGACTTTGAAGATGTTGGCCACAGTGATTCTGCTAGAGAGATGATGGATAAGTATTACATTGGGGAAATTGACATGTCAACA
GTTCCCCTAAAACGTGCTTCTATTCCATCGGAACAAACTGCATACAATCCAGACAAGACTCCAGAATTCATTXATCAAAATCCTACAGTT
CCTTGTACCCATCTTGATCTTGGGCTTGGCCTTAACAGTACGACACTACACCAAGGAGCAGTAATTCTTCTGAATTCCAGTCTATCAGGC
CCTCTTTTCTTGATTTATGtAGTTGTTGAAAGAACACTTGGTTAATCTTGTTTTAGTTCATTATCGAGCTGCAACAACTGAATGTGGTCG
TCAATTTTGTACTGTGCTTTACAATTGCTATGTCCGATGCCTCTTGGCAGCACTAGACTTGACCTGG\(3')TTCGTGTTTATTAGATAT
TTGAGAATATTTATCCTTCATGTTTAGATTTTTGTGTTTTCTTCTGGTTTGTACTGGTTAATTTTGTTGCAATCAACCTTACTAAGTTTC
GGGGAAGCTATTAGTCTATTAGTCATTGCAACTGTGAGAAATAAATAATATTTTAATTGTGTAAAAAAAAAAAAAAAAAAAACTCGAGAC
TAGTTCTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan