ESTScan Details for Unigene SGN-U270301

Score 
775
Direction 
Forward
Predicted Peptide Sequence 
MDAGSLSSVSASKTKSRCPLQEQYLQKRNSRENLDRFIPNRSAMDMDYAHYMLTEGRKGKENPAVDSPSREAYRKQLAETFNMNRTRILA
FKNKPPTSVEAIPNDFSSSVHQQAKTAKPRRYIPQTSERTLDAPDLVDDYYLNLLDWGSSNVLSIALGSTVYLWDASDGATSELVTVDEE
HGPVTSVKWAPDGRHIALGLNNSDXSALGYNGKSAAENLKGGHRSRVGALDWNNHVLTTGGMDGQIINNDVRVRSPIVDTYQRHHQEVCG
LKWSASGQQLAX
Predicted Coding Sequence 
ATGGATGCAGGATCATTGAGTTCTGTCTCAGCAAGTAAGACCAAATCTCGTTGCCCTCTCCAGGAACAATATCTACAAAAGAGGAATTCT
CGGGAAAATTTGGATAGGTTCATTCCTAATCGATCGGCAATGGATATGGACTATGCACATTACATGTTGACAGAGGGAAGGAAAGGTAAG
GAAAATCCAGCTGTTGATTCTCCCTCCAGAGAGGCATACAGGAAGCAGCTTGCGGAAACATTCAACATGAACAGGACCCGAATATTGGCG
TTCAAGAACAAGCCACCCACTTCTGTTGAGGCTATTCCAAACGACTTCTCATCATCTGTTCACCAACAGGCGAAGACTGCTAAACCCCGT
CGATACATTCCTCAGACCTCTGAAAGGACATTAGATGCTCCAGATCTAGTGGATGACTACTATTTGAATTTGTTAGATTGGGGCAGCAGC
AATGTTCTTTCTATTGCTCTAGGCAGCACTGTATATCTGTGGGATGCATCTGATGGTGCCACTTCAGAATTGGTCACTGTTGATGAAGAG
CATGGTCCTGTTACAAGTGTTAAATGGGCTCCTGATGGTAGACATATTGCTCTTGGTCTGAACAATTCTGATGXTTCAGCTCTGGGATAC
AACGGCAAATCGGCTGCTGAGAACTTGAAAGGTGGTCACAGATCCCGAGTTGGCGCTCTAGATTGGAACAATCACGTATTGACAACTGGG
GGCATGGATGGTCAGATCATAAACAATGATGTGAGGGTGCGATCGCCAATTGTGGATACATACCAAAGACATCACCAAGAAGTTTGTGGT
TTAAAATGGTCAGCCTCTGGCCAACAACTAGCTAXX\
Edits in Original Sequence 
CTTAAGCGAACCCGCAAGCGCACTTCCATCTTACTTGCTTTAATTTGTGCTGCAATATTATTATTATTATAACCCTGATTTTTGTTTTGC
AGGCTTTAATAATCTTGTTTCTTTGTTTATTGAAATCTCTGTTTTTGTATCTCTTTTTTTTTGTGCTAACACC
(5')ATGGATGCAGGAT
CATTGAGTTCTGTCTCAGCAAGTAAGACCAAATCTCGTTGCCCTCTCCAGGAACAATATCTACAAAAGAGGAATTCTCGGGAAAATTTGG
ATAGGTTCATTCCTAATCGATCGGCAATGGATATGGACTATGCACATTACATGTTGACAGAGGGAAGGAAAGGTAAGGAAAATCCAGCTG
TTGATTCTCCCTCCAGAGAGGCATACAGGAAGCAGCTTGCGGAAACATTCAACATGAACAGGACCCGAATATTGGCGTTCAAGAACAAGC
CACCCACTTCTGTTGAGGCTATTCCAAACGACTTCTCATCATCTGTTCACCAACAGGCGAAGACTGCTAAACCCCGTCGATACATTCCTC
AGACCTCTGAAAGGACATTAGATGCTCCAGATCTAGTGGATGACTACTATTTGAATTTGTTAGATTGGGGCAGCAGCAATGTTCTTTCTA
TTGCTCTAGGCAGCACTGTATATCTGTGGGATGCATCTGATGGTGCCACTTCAGAATTGGTCACTGTTGATGAAGAGCATGGTCCTGTTA
CAAGTGTTAAATGGGCTCCTGATGGTAGACATATTGCTCTTGGTCTGAACAATTCTGATGXTTCAGCTCTGGGATACAACGGCAAATCGG
CTGCTGAGAACTaTGAAAGGTGGTCACAGATCCCGAGTTGGCGCTCTAGATTGGAACAATCACGTATTGACAACTGGGGGCATGGATGGT
CAGATCATAAACAATGATGTGAGGGTGCGATCGCCAATTGTGGATACATACCAAAGACATCACCAAGAAGTTTGTGGTTTAAAATGGTCA
GCCTCTGGCCAACAACTAGCTAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan