ESTScan Details for Unigene SGN-U270310

Score 
603
Direction 
Forward
Predicted Peptide Sequence 
MSDRLTRIAIVSADKCKPKKAAKNARRAAPVVKTGKLCIEVTVGSKIAFISEELCIGCGICVKKCPFEAIQIINLPKDLDKDTTHRYGPN
TFKLHRLPVPRPGQVLGLVGTNGIGKSTALKVLAGKLKPNLGRFTNPPDWQEILTHFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAV
QGNVGQVLDQKDERDVKEKLCFDLELNQVLDRNVGDLSGGELQRFAIAVVAIQNAEIYMFDEPSSYLDVKQRLKAAQVVRSLLRPNSYVI
VVEHDLSVLDYLSDFICCLYGKPGAXGSCDPTLX
Predicted Coding Sequence 
ATGTCGGATAGATTGACGCGTATCGCCATCGTTAGCGCCGACAAGTGCAAGCCGAAGAAGGCCGCCAAGAATGCAAGAAGAGCTGCXCCA
GTTGTTAAAACTGGTAAGTTATGTATAGAGGTCACTGTAGGCTCGAAGATTGCTTTCATCTCAGAAGAGCTGTGTATTGGATGTGGTATT
TGTGTAAAGAAATGCCCATTTGAAGCAATTCAGATCATCAATCTGCCAAAAGATCTAGACAAGGATACAACCCATCGTTATGGTCCCAAC
ACTTTCAAATTGCACAGGTTACCTGTCCCTAGGCCAGGACAGGTTCTTGGTCTGGTTGGCACAAATGGAATTGGAAAGTCAACTGCCCTA
AAAGTTTTGGCTGGAAAATTGAAACCAAACTTGGGGCGCTTCACGAACCCTCCTGATTGGCAAGAAATCTTGACTCACTTTCGAGGATCC
GAACTGCAGAACTACTTCACTCGCATTCTGGAAGATAACTTAAAGGCAATTATCAAGCCTCAGTATGTCGACCATATTCCAAAGGCAGTT
CAAGGAAACGTTGGACAAGTGCTTGACCAAAAAGATGAGAGAGACGTGAAGGAAAAACTCTGTTTTGATCTAGAGCTGAATCAGGTTTTG
GATCGTAATGTAGGTGATCTATCTGGTGGAGAGCTTCAGAGGTTTGCTATTGCTGTTGTTGCAATACAAAATGCAGAGATATACATGTTT
GATGAGCCTTCAAGTTACCTTGATGTGAAGCAAAGGCTTAAAGCTGCCCAAGTTGTCAGATCCTTGCTTCGACCAAATAGCTATGTCATC
GTTGTGGAGCATGATCTTAGTGTGCTTGATTATTTGTCGGATTTCATTTGCTGCTTATATGGGAAGCCTGGTGCAXTAGGGAGTTGTGAC
CCTACCCTTCXX\
Edits in Original Sequence 
GCCGTGCCACCCACACTCCTCTCCTTTCTCTCTCTTAGGGTATAATTTTTCCTTTCTCTCTCTAACAAATCTGTCCATTACAGCCGTGCC
ACCCACACTCCTCTCCTTTCTCTCTCTTAGGGGATTTGGGATTCAGATCGGTGAAATAGAGACATC
(5')ATGTCGGATAGATTGACGCG
TATCGCCATCGTTAGCGCCGACAAGTGCAAGCCGAAGAAGtGCCGCCAAGAATGCAAGAAGAGCTGCXCCAGTTGTTAAAACTGGTAAGT
TATGTATAGAGGTCACTGTAGGCTCGAAGATTGCTTTCATCTCAGAAGAGCTGTGTATTGGATGTGGTATTTGTGTAAAGAAATGCCCAT
TTGAAGCAATTCAGATCATCAATCTGCCAAAAGATCTAGACAAGGATACAACCCATCGTTATGGTCCCAACACTTTCAAATTGCACAGGT
TACCTGTCCCTAGGCCAGGACAGGTTCTTGGTCTGGTTGGCACAAATGGAATTGGAAAGTCAACTGCCCTAAAAGTTTTGGCTGGAAAAT
TGAAACCAAACTTGGGGCGCTTCACGAACCCTCCTGATTGGCAAGAAATCTTGACTCACTTTCGAGGATCCGAACTGCAGAACTACTTCA
CTCGCATTCTGGAAGATAACTTAAAGGCAATTATCAAGCCTCAGTATGTCGACCATATTCCAAAGGCAGTTCAAGGAAACGTTGGACAAG
TGCTTGACCAAAAAGATGAGAGAGACGTGAAGGAAAAACTCTGTTTTGATCTAGAGCTGAATCAGGTTTTGGATCGTAATGTAGGTGATC
TATCTGGTGGAGAGCTTCAGAGGTTTGCTATTGCTGTTGTTGCAATACAAAATGCAGAGATATACATGTTTGATGAGCCTTCAAGTTACC
TTGATGTGAAGCAAAGGCTTAAAGCTGCCCAAGTTGTCAGATCCTTGCTTCGACCAAATAGCTATGTCATCGTTGTGGAGCATGATCTTA
GTGTGCTTGATTATTTGTCGGATTTCATTTGCTGCTTATATGGGAAGCCTGGTGCAXTAGGGAGTTGTGACCCTACCCTTCXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan