ESTScan Details for Unigene SGN-U270415

Score 
1257
Direction 
Forward
Predicted Peptide Sequence 
FSLFGLKSVLLSVQFNTAPIHILLLIVSSRKSEIYSEMASSALISDTESWKDLRAHVEEINKTHLRDLMNNTNRCQSMMVEFDGILIDYS
RQRATLDTLNKLFSLAEAARVKEKIIRMFNGEHINSTENRSVLHVALRAPRDAVINSDGKNVVPEVWHVLDKIRDFSERVRSGAWVGATG
KTLKDVVAVGIGGSFLGPLFVHTALQTEAEASECARGRQLRFLANVDPIDVARNITGLNPETTLVVVVSKTFTTAETMLNARTMREWISS
ALGPQAVAKHMVAVSTNLKLVEQFGIDPNNAFAFWDWVGGRYSVCSAVGVLPLSLQYGFSIVEKFLKGASSVDQHFLSAPFEKNIPVLLG
LLSVWNVSFLGYPARAILPYSQALEKLAPHIQQVSMESNGKGVSIDGVPLPYQTGEIDFGEPGTNGQHSFYQLIHQGRVIPCDFIGVVKS
QQPIYLKDEVVNNHDELMSNFFAQPDALAYGKTPEQLQKENIPEHLVSHKTFSGNRPSLSILLPSLNAYNIGQLLAIYEHRVAVQGFVWC
INSFDQWGVELGKSLATQVRKQLHASRKKGESVEGFNFSTKTLITRYLEASADVPSDPSTLLPNIEXMLRMGFDDHGLTEASTSLPSKMN
KF
Predicted Coding Sequence 
XCTTTTTCCCTTTTTGGCCTTAAATCAGTACTTCTATCTGTTCAATTCAACACAGCTCCAATTCATATTCTTCTCCTAATCGTCTCGTCT
CGAAAGAGTGAAATTTATTCAGAGATGGCTTCGTCTGCTTTAATTAGCGATACTGAGTCCTGGAAGGATTTGCGAGCTCATGTTGAAGAA
ATTAACAAAACTCATTTACGTGATTTGATGAATAACACTAATCGATGCCAATCAATGATGGTGGAGTTTGATGGGATTCTGATCGATTAC
TCGAGACAAAGAGCCACCCTTGATACATTGAATAAGCTCTTCAGTTTAGCTGAGGCAGCACGTGTTAAGGAGAAGATCATTCGGATGTTC
AATGGAGAGCATATAAACAGCACAGAAAACAGATCTGTTCTTCATGTTGCACTGCGTGCTCCTAGGGATGCAGTCATAAATAGTGACGGG
AAGAATGTTGTCCCTGAGGTTTGGCACGTACTTGATAAGATCCGAGACTTCTCTGAGAGGGTTCGCAGTGGTGCCTGGGTTGGAGCCACA
GGAAAAACACTGAAAGATGTTGTAGCTGTTGGTATAGGTGGCAGTTTCTTAGGCCCTTTGTTCGTACACACAGCACTTCAAACAGAAGCG
GAGGCTAGTGAGTGTGCAAGAGGGCGCCAGTTGCGATTTCTTGCAAATGTTGATCCCATTGATGTAGCCCGAAATATAACAGGCTTGAAT
CCTGAAACAACTCTAGTTGTGGTGGTCTCGAAGACTTTTACTACTGCCGAGACAATGCTAAATGCCCGTACAATGAGGGAATGGATCTCC
TCTGCATTAGGACCTCAGGCAGTTGCAAAGCATATGGTTGCAGTTAGTACCAATCTTAAGCTCGTAGAACAATTTGGCATCGATCCAAAT
AATGCATTCGCTTTCTGGGACTGGGTAGGAGGTCGATATAGTGTCTGCAGCGCAGTTGGAGTATTGCCTCTTTCTCTGCAATATGGATTT
TCCATTGTTGAGAAATTTCTGAAGGGAGCTTCGAGTGTTGATCAGCATTTCCTCTCAGCACCATTTGAGAAAAATATACCTGTGCTTTTA
GGCTTGCTGAGTGTGTGGAATGTTTCATTCCTTGGATATCCAGCAAGAGCAATATTACCCTATTCTCAAGCACTGGAGAAGTTGGCACCT
CATATTCAACAGGTCAGTATGGAGAGTAATGGGAAAGGGGTGTCTATTGATGGTGTCCCTCTTCCTTACCAGACTGGTGAAATTGACTTT
GGTGAACCAGGGACGAATGGCCAACACAGCTTTTACCAATTAATTCATCAGGGTCGTGTTATTCCTTGTGATTTTATTGGTGTTGTTAAG
AGTCAGCAACCTATTTACCTGAAAGATGAAGTGGTGAATAACCATGATGAGCTCATGTCGAACTTCTTTGCGCAGCCAGATGCCCTTGCT
TATGGGAAGACACCAGAGCAGTTGCAAAAGGAGAATATTCCTGAGCATCTTGTTTCTCATAAGACATTTTCTGGAAATCGACCTTCTCTA
AGTATACTACTTCCATCATTGAATGCTTACAACATTGGACAGTTACTGGCCATCTACGAGCACAGAGTTGCAGTCCAAGGCTTTGTATGG
TGTATCAATTCTTTTGATCAGTGGGGTGTGGAGCTAGGAAAGTCTCTAGCGACTCAAGTTAGAAAGCAACTTCATGCATCTCGTAAGAAA
GGAGAATCAGTTGAAGGCTTCAATTTCAGCACCAAAACGTTGATAACAAGATATCTCGAGGCAAGTGCTGATGTTCCTTCTGATCCTTCA
ACTCTTCTACCAAATATTGAGGAXATGTTAAGAATGGGGTTTGATGACCACGGTTTAACGGAAGCCTCAACTTCACTACCAAGCAAAATG
AACAAATTTTAA\
Edits in Original Sequence 
(5')XCTTTTTCCCTTTTTGGCCTTAAATCAGTACTTCTATCTGTTCAATTCAACACAGCTCCAATTCATATTCTTCTCCTAATCGTCTC
GTCTCGAAAGAGTGAAATTTATTCAGAGATGGCTTCGTCTGCTTTAATTAGCGATACTGAGTCCTGGAAGGATTTGCGAGCTCATGTTGA
AGAAATTAACAAAACTCATTTACGTGATTTGATGAATAACACTAATCGATGCCAATCAATGATGGTGGAGTTTGATGGGATTCTGATCGA
TTACTCGAGACAAAGAGCCACCCTTGATACATTGAATAAGCTCTTCAGTTTAGCTGAGGCAGCACGTGTTAAGGAGAAGATCATTCGGAT
GTTCAATGGAGAGCATATAAACAGCACAGAAAACAGATCTGTTCTTCATGTTGCACTGCGTGCTCCTAGGGATGCAGTCATAAATAGTGA
CGGGAAGAATGTTGTCCCTGAGGTTTGGCACGTACTTGATAAGATCCGAGACTTCTCTGAGAGGGTTCGCAGTGGTGCCTGGGTTGGAGC
CACAGGAAAAACACTGAAAGATGTTGTAGCTGTTGGTATAGGTGGCAGTTTCTTAGGCCCTTTGTTCGTACACACAGCACTTCAAACAGA
AGCGGAGGCTAGTGAGTGTGCAAGAGGGCGCCAGTTGCGATTTCTTGCAAATGTTGATCCCATTGATGTAGCCCGAAATATAACAGGCTT
GAATCCTGAAACAACTCTAGTTGTGGTGGTCTCGAAGACTTTTACTACTGCCGAGACAATGCTAAATGCCCGTACAATGAGGGAATGGAT
CTCCTCTGCATTAGGACCTCAGGCAGTTGCAAAGCATATGGTTGCAGTTAGTACCAATCTTAAGCTCGTAGAACAATTTGGCATCGATCC
AAATAATGCATTCGCTTTCTGGGACTGGGTAGGAGGTCGATATAGTGTCTGCAGCGCAGTTGGAGTATTGCCTCTTTCTCTGCAATATGG
ATTTTCCATTGTTGAGAAATTTCTGAAGGGAGCTTCGAGTGTTGATCAGCATTTCCTCTCAGCACCATTTGAGAAAAATATACCTGTGCT
TTTAGGCTTGCTGAGTGTGTGGAATGTTTCATTCCTTGGATATCCAGCAAGAGCAATATTACCCTATTCTCAAGCACTGGAGAAGTTGGC
ACCTCATATTCAACAGGTCAGTATGGAGAGTAATGGGAAAGGGGTGTCTATTGATGGTGTCCCTCTTCCTTACCAGACTGGTGAAATTGA
CTTTGGTGAACCAGGGACGAATGGCCAACACAGCTTTTACCAATTAATTCATCAGGGTCGTGTTATTCCTTGTGATTTTATTGGTGTTGT
TAAGAGTCAGCAACCTATTTACCTGAAAGATGAAGTGGTGAATAACCATGATGAGCTCATGTCGAACTTCTTTGCGCAGCCAGATGCCCT
TGCTTATGGGAAGACACCAGAGCAGTTGCAAAAGGAGAATATTCCTGAGCATCTTGTTTCTCATAAGACATTTTCTGGAAATCGACCTTC
TCTAAGTATACTACTTCCATCATTGAATGCTTACAACATTGGACAGTTACTGGCCATCTACGAGCACAGAGTTGCAGTCCAAGGCTTTGT
ATGGTGTATCAATTCTTTTGATCAGTGGGGTGTGGAGCTAGGAAAGTCTCTAGCGACTCAAGTTAGAAAGCAACTTCATGCATCTCGTAA
GAAAGGAGAATCAGTTGAAGGCTTCAATTTCAGCACCAAAACGTTGATAACAAGATATCTCGAGGCAAGTGCTGATGTTCCTTCTGATCC
TTCAACTCTTCTACCAAATATaTGAGGAXATGTTAAGAATGGGGTTTGATGACCACGGTTTAACGGAAGCCTCAACTTCACTACCAAGCA
AAATGAACAAATTTTAA\(3')TCAATTAGTTTTGAAGTTTACATAAAAGATTTGGTGTTGTATGGTCACTCATCTTGGCAAACATATCG
CTGCAGTTGTATCAATAAAATTCAAAGCATTTATTTGTGGTTTCATTTGTAAAAATAATGGTCTTTTAACTTGGAAGTCGGTGTCAGTTT
GTGAAAGTGAACAAAGTATTAACCTGATTGTGAAAAAAATAATTTTCTATTGAAAAAAAAAAAAAAAAAAAAAAAACTCGAGACTAGTTC
TC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan