ESTScan Details for Unigene SGN-U270505

Score 
1303
Direction 
Forward
Predicted Peptide Sequence 
MNCSISGEVPEDPVVSKKSGLLFEKRLIERHISDYGKCPITGEPLTADDIIPVKTGKIVKPRPVQAASIPGDVGNVPNRMGWPDAVKFCI
GTTITYCKARAEPCFISADAACRVIARLKKERDEARGFLAQAERQIPMAATTAAGTTAVSNGKRAAEDEDTGPDGKKIRPGISHSVIETL
TECNAGLSQQRKKRQIPATLAPVDALARYTQLNSFPLHKTNKPGILSLDIHYAKDIIATGGVDSNAVIFDRPSGQIISTLSGHSKRVTSV
KFAAEGELVVSGSADKTVRVWQSSENGNYDCRHVLKDHTAEVQAVTVHATNNYFVTASLDSTWCFYDLASGLCLTQVADASESEGYTSAA
FHPDGLILGTGTSGSLVKIWDVKSQANVAKFDGHVGSVTAISFSENGYFLATAAHDGVKLWDLRKLKNFRTFAPYDENTPTQSVEFDHSG
SYLALEAQIYEFIKSPVKADWNHIKTFPDLSGTGKATCLKFGPDASYIAVGSMDRNLRIFGLPGXGSNGGLGSFPALKQTASSFASAARS
QCYLEGRRSMSPVL
Predicted Coding Sequence 
ATGAACTGTTCAATTTCCGGCGAGGTGCCGGAGGATCCAGTAGTTTCGAAGAAGTCCGGACTCCTTTTCGAAAAGCGTTTAATTGAAAGA
CATATCTCTGATTATGGCAAATGTCCTATTACTGGAGAGCCATTGACGGCAGATGACATTATCCCTGTTAAAACTGGCAAGATAGTTAAA
CCCCGACCTGTACAGGCTGCTAGCATTCCTGGXGATGTTGGGAATGTTCCAAATAGAATGGGATGGCCTGATGCTGTCAAATTTTGCATT
GGAACAACAATTACATACTGCAAGGCAAGAGCTGAGCCATGCTTTATATCAGCTGATGCTGCTTGCAGGGTAATTGCAAGGCTGAAAAAG
GAAAGGGATGAGGCAAGGGGGTTTCTTGCCCAGGCTGAAAGACAAATACCCATGGCAGCCACTACAGCAGCTGGTACTACTGCTGTAAGC
AATGGGAAAAGAGCTGCTGAGGATGAGGATACGGGCCCTGATGGAAAGAAAATTCGCCCTGGGATATCACACTCTGTCATTGAGACTCTT
ACTGAATGTAATGCTGGTCTTTCACAACAAAGGAAAAAACGACAGATACCGGCAACATTGGCCCCTGTGGATGCTTTGGCGAGATATACC
CAACTGAATAGTTTTCCTCTTCACAAAACCAACAAACCGGGCATTTTGTCTTTGGATATTCATTATGCTAAGGACATAATTGCTACTGGT
GGAGTTGATTCAAATGCTGTGATCTTTGATCGACCTTCAGGACAGATCATATCAACACTAAGTGGTCATTCAAAGAGGGTTACCAGTGTT
AAGTTTGCGGCTGAGGGTGAACTCGTGGTCTCTGGTTCAGCAGATAAGACGGTTCGTGTGTGGCAAAGTTCTGAAAATGGAAATTATGAC
TGTAGGCATGTCTTGAAGGATCATACAGCAGAGGTGCAAGCTGTCACTGTCCATGCAACCAATAATTATTTTGTTACTGCTTCTCTTGAT
AGCACGTGGTGCTTTTATGATCTTGCTTCTGGTTTATGCCTTACACAGGTAGCAGATGCTTCAGAATCTGAGGGCTATACTTCCGCAGCT
TTCCACCCTGATGGTCTGATCCTTGGAACAGGGACTTCAGGGTCTCTGGTCAAGATATGGGATGTAAAAAGTCAGGCAAATGTTGCAAAA
TTTGATGGCCATGTTGGGTCTGTAACTGCTATTTCCTTTTCAGAAAATGGTTATTTCTTAGCAACTGCTGCTCATGATGGTGTTAAACTT
TGGGATTTACGCAAATTGAAGAACTTTAGAACTTTCGCTCCTTATGATGAAAACACACCAACTCAATCAGTGGAATTTGACCATAGTGGA
AGTTATCTTGCCTTGGAGGCTCAGATATACGAGTTTATCAAGTCGCCAGTCAAGGCTGATTGGAATCACATCAAAACCTTCCCTGACTTA
TCAGGCACAGGCAAAGCAACATGTCTGAAATTTGGTCCAGATGCATCGTACATAGCTGTCGGATCTATGGACCGCAATTTAAGAATATTC
GGGCTGCCTGGTGXAGGATCAAATGGAGGGTTAGGCTCATTTCCAGCGTTAAAGCAAACAGCTTCTTCCTTTGCATCTGCTGCAAGATCA
CAGTGCTATCTCGAGGGTAGGAGGTCGATGAGTCCTGTTCTTTAA\
Edits in Original Sequence 
CCTCGCTCTCACTCTGCATCAGCTCCTTTTGTGCTGCTTAAACCCTAGCTCTACCTCTTTGCCTTTCTCTCTCTTTCAACA(5')ATGAA
CTGTTCAATTTCCGGCGAGGTGCCGGAGGATCCAGTAGTTTCGAAGAAGTCCGGACTCCTTTTCGAAAAGCGTTTAATTGAAAGACATAT
CTCTGATTATGGCAAATGTCCTATTACTGGAGAGCCATTGACGGCAGATGACATTATCCCTGTTAAAACTGGCAAGATAGTTAAACCCCG
ACCTGTACAGGCTGCTAGCATTCCTGGXGATGTTGGGAATGTTCCAAATAGAATGGGATGGCCTGATGCTGTCAAATTTTGCATTGGAAC
AACAATTACATACTGCAAGGCAAGAGCTGAGCCATGCTTTATATCAGCaTGATGCTGCTTGCAGGGTAATTGCAAGGCTGAAAAAGGAAA
GGGATGAGGCAAGGGGGTTTCTTGCCCAGGCTGAAAGACAAATACCCATGGCAGCCACTACAGCAGCTGGTACTACTGCTGTAAGCAATG
GGAAAAGAGCTGCTGAGGATGAGGATACGGGCCCTGATGGAAAGAAAATTCGCCCTGGGATATCACACTCTGTCATTGAGACTCTTACTG
AATGTAATGCTGGTCTTTCACAACAAAGGAAAAAACGACAGATACCGGCAACATTGGCCCCTGTGGATGCTTTGGCGAGATATACCCAAC
TGAATAGTTTTCCTCTTCACAAAACCAACAAACCGGGCATTTTGTCTTTGGATATTCATTATGCTAAGGACATAATTGCTACTGGTGGAG
TTGATTCAAATGCTGTGATCTTTGATCGACCTTCAGGACAGATCATATCAACACTAAGTGGTCATTCAAAGAGGGTTACCAGTGTTAAGT
TTGCGGCTGAGGGTGAACTCGTGGTCTCTGGTTCAGCAGATAAGACGGTTCGTGTGTGGCAAAGTTCTGAAAATGGAAATTATGACTGTA
GGCATGTCTTGAAGGATCATACAGCAGAGGTGCAAGCTGTCACTGTCCATGCAACCAATAATTATTTTGTTACTGCTTCTCTTGATAGCA
CGTGGTGCTTTTATGATCTTGCTTCTGGTTTATGCCTTACACAGGTAGCAGATGCTTCAGAATCTGAGGGCTATACTTCCGCAGCTTTCC
ACCCTGATGGTCTGATCCTTGGAACAGGGACTTCAGGGTCTCTGGTCAAGATATGGGATGTAAAAAGTCAGGCAAATGTTGCAAAATTTG
ATGGCCATGTTGGGTCTGTAACTGCTATTTCCTTTTCAGAAAATGGTTATTTCTTAGCAACTGCTGCTCATGATGGTGTTAAACTTTGGG
ATTTACGCAAATTGAAGAACTTTAGAACTTTCGCTCCTTATGATGAAAACACACCAACTCAATCAGTGGAATTTGACCATAGTGGAAGTT
ATCTTGCCTTaGGAGGCTCAGATATACGAGTTTATCAAGTCGCCAGTCAAGGCTGATTGGAATCACATCAAAACCTTCCCTGACTTATCA
GGCACAGGCAAAGCAACATGTCTGAAATTTGGTCCAGATGCATCGTACATAGCTGTCGGATCTATGGACCGCAATTTAAGAATATTCGGG
CTGCCTGGTGXAGGATCAAATGGAGGGTTAGGCTCATTTCCAGCGTTAAAGCAAACAGCTTCTTCCTTTGCATCTGCTGCAAGATCACAG
TGCTATCTCGAGGGTAGGAGGTCGATGAGTCCTGTTCTTTAA\(3')TATGTAGGTTCTTCTGGTTTTTGCTAAATTTTGGGGTGGGCAG
GCTAATAGACATATAACCACAAACTTGGGATAACATCTGAGGTGCAGAGTTTATTCAGTCAATCCCAAAACCAGCCTTGGGTTAGTATTG
TGTTGTATCATTCTTGTGTAACCGTATCGTCCTTCCTGGAAGCAAAACTCTGAATGGATAATGATCAGTTACAGTACATTGAGATGTTAT
GTTTGTAGCCATAGTAATATTGCATTAAAGGATTTTCCATGATGGTTACTAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan