ESTScan Details for Unigene SGN-U270604

Score 
131
Direction 
Forward
Predicted Peptide Sequence 
ASKDPQRLSYLSSLVVSKKPTNVPIASGQQLFNIGNYVVRVKMGTPGQQMYMVLDTSNDAAFVPCSGCVGCSSNTLFAPSTSTTFGSVDC
SVPECTQVRGSLSCPTTGSVVGSSTACFFNQSYGGDSSFYATLSHDTLGLANDVVPNYAFGCISSVSGTSIPPQGLLGLGRGSMSLMSQS
GSLYSGVFSYCLPSFKSYYFSGSLKLGLVGQPKNIKTTPLLRNPRRPSLYYVNLTSVSVGRVPVPIAPEHLAFDPNTGAGTVIXLGYSHN
PIRPTPYEVIRDEFRKQVNGTFSSLGAFDTCFVSQNEAVIPTITLHFEGMDLKLPMENTLIHSSATPLACLAIASAPNNVNSVLNVIANL
QQQNLRIMFDTANSRVGIAREVCN
Predicted Coding Sequence 
XXGGCCTCTAAAGATCCACAAAGGCTCTCTTATTTATCAAGTTTAGTTGTGTCCAAAAAGCCCACTAATGTTCCCATTGCTTCAGGCCAA
CAACTCTTCAATATAGGTAACTATGTGGTTCGGGTCAAGATGGGTACTCCGGGTCAACAAATGTACATGGTTTTGGATACAAGTAATGAT
GCTGCATTTGTTCCATGTAGTGGTTGTGTTGGTTGCTCTTCTAATACTTTGTTTGCCCCATCTACTTCCACTACTTTCGGGTCGGTGGAC
TGCTCCGTACCCGAATGTACTCAAGTCCGAGGGAGTCTCTCGTGCCCGACTACTGGGTCAGTAGTCGGGTCAAGTACTGCTTGCTTTTTT
AACCAATCGTATGGCGGAGATTCATCTTTCTACGCTACGTTGTCACATGACACCCTTGGACTAGCCAATGACGTTGTCCCGAATTATGCT
TTCGGGTGCATAAGTTCCGTGTCCGGGACCTCAATTCCACCACAAGGGTTATTGGGCTTGGGCCGTGGGTCAATGTCATTGATGTCACAA
TCTGGATCTCTTTATTCTGGCGTATTCTCATACTGTTTGCCTAGTTTTAAATCATATTATTTCTCTGGATCACTCAAGCTCGGACTCGTG
GGCCAACCCAAAAATATTAAAACCACCCCACTACTAAGGAACCCGAGACGACCATCTTTGTACTACGTGAACCTGACAAGTGTAAGCGTG
GGGCGAGTTCCGGTCCCGATTGCACCTGAACACCTTGCGTTTGACCCAAACACCGGTGCGGGCACAGTAATTGAXCTCGGGTACAGTCAT
AACCCGATTCGTCCAACCCCTTACGAGGTGATTAGGGATGAATTTAGGAAACAAGTGAATGGGACATTTAGCTCATTAGGTGCATTTGAT
ACATGTTTTGTATCACAAAATGAGGCAGTGATACCAACTATAACATTGCACTTTGAGGGAATGGACTTGAAATTGCCAATGGAGAACACA
TTGATACATAGTAGTGCCACTCCCTTAGCATGTTTGGCTATTGCTTCAGCTCCAAATAATGTGAATTCAGTGTTGAATGTGATAGCCAAT
TTGCAACAACAAAATCTTAGGATTATGTTTGACACAGCTAATTCTCGCGTTGGAATTGCTCGCGAAGTTTGCAATTAA\
Edits in Original Sequence 
(5')XXGGCCTCTAAAGATCCACAAAGGCTCTCTTATTTATCAAGTTTAGTTGTGTCCAAAAAGCCCACTAATGTTCCCATTGCTTCAGG
CCAACAACTCTTCAATATAGGTAACTATGTGGTTCGGGTCAAGATGGGTACTCCGGGTCAACAAATGTACATGGTTTTGGATACAAGTAA
TGATGCTGCATTTGTTCCATGTAGTGGTTGTGTTGGTTGCTCTTCTAATACTTTGTTTGCCCCATCTACTTCCACTACTTTCGGGTCGGT
GGACTGCTCCGTACCCGAATGTACTCAAGTCCGAGGGAGTCTCTCGTGCCCGACTACTGGGTCAGTAGTCGGGTCAAGTACTGCTTGCTT
TTTTAACCAATCGTATGGCGGAGATTCATCTTTCTACGCTACGTTGTCACATGACACCCTTGGACTAGCCAATGACGTTGTCCCGAATTA
TGCTTTCGGGTGCATAAGTTCCGTGTCCGGGACCTCAATTCCACCACAAGGGTTATTGGGCTTGGGCCGTGGGTCAATGTCATTGATGTC
ACAATCTGGATCTCTTTATTCTGGCGTATTCTCATACTGTTTGCCTAGTTTTAAATCATATTATTTCTCTGGATCACTCAAGCTCGGACT
CGTGGGCCAACCCAAAAATATTAAAACCACCCCACTACTAAGGAACCCGAGACGACCATCTTTGTACTACGTGAACCTGACAAGTGTAAG
CGTGGGGCGAGTTCCGGTCCCGATTGCACCTGAACACCTTGCGTTTGACCCAAACACCGGTGCGGGCACAGTAATTGAXCTCGGGTACAG
TCATAACCCGATTCGTCCAACCCgCTTACGAGGTGATTAGGGATGAATTTAGGAAACAAGTGAATGGGACATTTAGCTCATTAGGTGCAT
TTGATACATGTTTTGTATCACAAAATGAGGCAGTGATACCAACTATAACATTGCACTTTGAGGGAATGGACTTGAAATTGCCAATGGAGA
ACACATTGATACATAGTAGTGCCACTCCCTTAGCATGTTTGGCTATTGCTTCAGCTCCAAATAATGTGAATTCAGTGTTGAATGTGATAG
CCAATTTGCAACAACAAAATCTTAGGATTATGTTTGACACAGCTAATTCTCGCGTTGGAATTGCTCGCGAAGTTTGCAATTAA\(3')AT
TTGAATCGTACCCTCAAAAATGTAGTCACACCTGTGTCTGATACTCCAAAAATGATGGACGACATTGTTATTATTATTAAGTCTTTGCTT
TCCTTGTAATTCAATGTAGTGGACTTGGTGAAAAAGGTCATCAAGTACTTTAATTTCCTTGTGTTACTATTTGGAATGAATTAATGTTAT
GTTCAGTAATTTGGTGCATTTAAAAAAAATAATAATAAAAAAAAAC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan