ESTScan Details for Unigene SGN-U270657

Score 
842
Direction 
Forward
Predicted Peptide Sequence 
MSDQNLETMSIDPNVDPYGYLGMVRNSDGSITRLQKPLVPIDTSNDLSHLVITKDITINCSKNTWARIILPCELLYSTTSTPKLPLVIYF
HGGGFIVATVDSPSFQGLYASIASEIPAVVVSIEYRQAPEHRLPAAYDDCMEALHWIKNKPDELLSNHADFSKCFLVGTSAGGNVVYHVG
LHAAESWDNLKPLEIKGLILNQPFFGGNERTQSEVRLSNDKVLPPIISDIMWDLGLPKGADRDHEYSNPMVGIESNPNLLDQVKLLGWKM
LVTGCDGDPLIDRQVDLVMVLKELGVQVEGSFTQGFYHGSEIIDPLKAKEFSLLVKELIRHF
Predicted Coding Sequence 
ATGTCTGATCAAAATCTTGAAACTATGTCAATTGATCCTAATGTTGATCCCTATGGCTATTTGGGCATGGTTCGTAATTCTGATGGTTCC
ATCACACGTCTACAAAAACCTCTTGTTCCGATAGACACATCTAATGATCTTTCCCATCTAGTCATCACCAAAGATATTACTATTAACTGC
TCAAAGAACACATGGGCACGTATTATACTCCCTTGTGAACTTCTCTATTCCACAACCAGTACTCCTAAACTTCCTCTCGTGATCTATTTT
CACGGAGGAGGATTCATAGTAGCAACTGTAGATTCGCCTAGCTTTCAAGGATTATACGCGTCAATTGCTAGTGAAATTCCAGCAGTTGTT
GTATCAATTGAGTATCGTCAAGCCCCTGAGCATAGACTTCCAGCAGCATACGACGATTGCATGGAAGCTTTGCATTGGATCAAGAACAAA
CCCGACGAGCTATTATCCAACCACGCTGATTTCTCCAAATGCTTCCTAGTGGGCACGAGTGCCGGAGGCAACGTGGTGTACCACGTGGGC
CTACACGCCGCGGAGAGTTGGGACAACCTCAAGCCTTTGGAAATCAAGGGGTTGATATTGAATCAACCTTTCTTTGGTGGGAATGAGAGG
ACACAATCAGAAGTAAGATTGTCTAATGACAAGGTGTTACCCCCAATTATAAGTGATATCATGTGGGACCTAGGATTGCCTAAAGGTGCT
GATCGCGATCATGAGTATTCAAATCCAATGGTGGGGATTGAATCAAACCCGAACTTATTGGATCAAGTAAAATTATTAGGATGGAAAATG
TTGGTGACTGGTTGTGATGGTGATCCTTTAATTGACCGCCAAGTTGACCTAGTAATGGTGTTGAAAGAATTGGGCGTTCAAGTAGAGGGT
AGTTTCACTCAAGGATTTTATCACGGATCGGAGATTATTGATCCTTTGAAAGCTAAAGAATTTTCCTTACTTGTAAAGGAACTTATACGT
CACTTTTAA\
Edits in Original Sequence 
TTTTTTTTTTTTTGAAATTGATGATATATTTATATATCAAAGAGTTGACTCATCTTAACGAATACCAAAGAGTTGACTTGCCAACCATGT
ATACACACTACTCTTTATTTTAAAGAATTGTTCATACATTCACAATCTTCTATCTCTAAACACTGCATTACAAGC
(5')ATGTCTGATCA
AAATCTTGAAACTATGTCAATTGATCCTAATGTTGATCCCTATGGCTATTTGGGCATGGTTCGTAATTCTGATGGTTCCATCACACGTCT
ACAAAAACCTCTTGTTCCGATAGACACATCTAATGATCTTTCCCATCTAGTCATCACCAAAGATATTACTATTAACTGCTCAAAGAACAC
ATGGGCACGTATTATACTCCCTTGTGAACTTCTCTATTCCACAACCAGTACTCCTAAACTTCCTCTCGTGATCTATTTTCACGGAGGAGG
ATTCATAGTAGCAACTGTAGATTCGCCTAGCTTTCAAGGATTATACGCGTCAATTGCTAGTGAAATTCCAGCAGTTGTTGTATCAATTGA
GTATCGTCAAGCCCCTGAGCATAGACTTCCAGCAGCATACGACGATTGCATGGAAGCTTTGCATTGGATCAAGAACAAACCCGACGAGCT
ATTATCCAACCACGCTGATTTCTCCAAATGCTTCCTAGTGGGCACGAGTGCCGGAGGCAACGTGGTGTACCACGTGGGCCTACACGCCGC
GGAGAGTTGGGACAACCTCAAGCCTTTGGAAATCAAGGGGTTGATATTGAATCAACCTTTCTTTGGTGGGAATGAGAGGACACAATCAGA
AGTAAGATTGTCTAATGACAAGGTGTTACCCCCAATTATAAGTGATATCATGTGGGACCTAGGATTGCCTAAAGGTGCTGATCGCGATCA
TGAGTATTCAAATCCAATGGTGGGGATTGAATCAAACCCGAACTTATTGGATCAAGTAAAATTATTAGGATGGAAAATGTTGGTGACTGG
TTGTGATGGTGATCCTTTAATTGACCGCCAAGTTGACCTAGTAATGGTGTTGAAAGAATTGGGCGTTCAAGTAGAGGGTAGTTTCACTCA
AGGATTTTATCACGGATCGGAGATTATTGATCCTTTGAAAGCTAAAGAATTTTCCTTACTTGTAAAGGAACTTATACGTCACTTTTAA\
(3')GGGGAATTGCTTTGTATAATTGTAATAGTATTAGTATTGCCCCTCCCCANAAAATGTGATAGCGGATAAGCAGATCTGCCATGATTA
TGTAATGATGCATATTAATTATAAATATAATATAAGTTTCCCCAAAAAAACCAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan