ESTScan Details for Unigene SGN-U270672

Score 
527
Direction 
Forward
Predicted Peptide Sequence 
MAKLVSFFLLALIAISMVATTALAADAQYHLDRSRYGPGSLKPTQCLPQCTRRCSKTQYHKPCMFFCQKCCKTCLCVPPGFYGNKGVCPC
YNNWKTKEGGPKCP
Predicted Coding Sequence 
ATGGCGAAGCTTGTTTCATTTTTCCTTTTGGCCCTTATTGCCATTTCCATGGTTGCAACCACTGCTCTAGCTGCTGATGCCCAGTACCAC
CTTGATCGTTCAAGGTATGGTCCAGGGAGCTTGAAGCCAACACAATGCCTGCCACAATGTACAAGAAGATGTAGCAAGACACAGTACCAC
AAGCCATGCATGTTCTTTTGCCAGAAATGCTGTAAGACATGCCTATGTGTTCCTCCTGGTTTCTATGGAAACAAAGGTGTTTGCCCATGC
TACAACAACTGGAAGACCAAAGAAGGAGGACCAAAATGCCCTTAA\
Edits in Original Sequence 
TTCACAAAGAAAGCCTCTCTTTTCTTTTGCTTTCTGTGAAGCAAAATCAGCA(5')ATGGCGAAGCTTGTTTCATTTTTCCTTTTGGCCC
TTATTGCCATTTCCATGGTTGCAACCACTGCTCTAGCTGCTGATGCCCAGTACCACCTTGATCGTTCAAGGTATGGTCCAGGGAGCTTGA
AGCCAACACAATGCCTGCCACAATGTACAAGAAGATGTAGCAAGACACAGTACCACAAGCCATGCATGTTCTTTTGCCAGAAATGCTGTA
AGACATGCCTATGTGTTCCTCCTGGTTTCTATGGAAACAAAGGTGTTTGCCCATGCTACAACAACTGGAAGACCAAAGAAGGAGGACCAA
AATGCCCTTAA\(3')TTAATTAACCACATTGCTACTCTAAATTTGTCACCCCAAAGTTTAATTGATATTGTTGTTTATTGGTCTTCTTG
ATCCTATTATTATTATTTTGTCTGAATTAAGAGGTCATTAGTTGTATGACCTTTTTTACTTTTGTGTATGTATTTGCTCCTTTGGGCAGT
ATTGCCCGATATGAGAGCTGTTTGACCAATTTTTCTGTTGGTCTATTGTTATGTTACTCTTTTCTAATATAACAAAAAATCTTGTCCAAA
AAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan