ESTScan Details for Unigene SGN-U270778

Score 
652
Direction 
Forward
Predicted Peptide Sequence 
VRAKNGLSNTAIRWVEVPTNFDNKACESEYYHHQSKQKPKIVVQAAAVVANAQTRERLKLKEMFEDAYERCRTTPMEGVAFTVDDFHSAL
EKYDFDSEVGTKVKGTVFSVDANGALVDITAKSSAYLPLREASLHTIRHVEEAGIFPGLREEFVVVGENEADDSLVLSLRSIQYDLAWER
CRQLQAEDVVIKGKVVGANKGGXGRSGGGPSWX
Predicted Coding Sequence 
GTGAGAGCGAAAAATGGCTTGTCTAACACAGCAATTCGTTGGGTTGAAGTGCCCACCAATTTCGACAACAAGGCTTGTGAATCCGAGTAT
TATCATCATCAGAGTAAGCAGAAGCCAAAAATTGTAGTACAAGCTGCAGCAGTGGTTGCAAATGCACAAACAAGAGAAAGACTAAAACTT
AAAGAGATGTTTGAGGATGCCTATGAGAGATGCCGCACTACACCTATGGAAGGTGTTGCCTTTACTGTTGATGATTTTCATTCTGCCCTT
GAAAAATATGATTTTGACTCCGAAGTTGGTACTAAGGTCAAAGGAACGGTTTTTTCTGTAGATGCAAACGGAGCTCTAGTTGACATTACT
GCAAAATCATCTGCATACTTGCCTTTACGAGAAGCTTCACTTCACACCATCAGACATGTAGAGGAAGCCGGAATATTTCCTGGTTTGCGT
GAGGAGTTTGTGGTAGTTGGAGAAAATGAAGCTGATGATAGTTTGGTTTTGAGCTTGCGATCAATTCAGTATGACCTTGCATGGGAGAGA
TGCAGGCAGCTTCAAGCTGAAGATGTTGTCATCAAAGGCAAGGTGGTTGGTGCAAATAAAGGTGGAGXTGGTCGCTCTGGTGGAGGGCCT
TCGTGGTXX\
Edits in Original Sequence 
(5')GTGAGAGCGAAAAATGGCTTGTCTAACACAGCAATTCGTTGGGTTGAAGTGCCCACCAATTTCGACAACAAGGCTTGTGAATCCGA
GTaATTATCATCATCAGAGTAAGCAGAAGCCAAAAATTGTAGTACAAGCTGCAGCAGTGGTTGCAAATGCACAAACAAGAGAAAGACTAA
AACTTAAAGAGATGTTTGAGGATGCCTATGAGAGATGCCGCACTACACCTATGGAAGGTGTTGCCTTTACTGTTGATGATTTTCATTCTG
CCCTTGAAAAATATGATTTTGACTCCGAAGTTGGTACTAAGGTCAAAGGAACGGTTTTTTCTGTAGATGCAAACGGAGCTCTAGTTGACA
TTACTGCAAAATCATCTGCATACTTGCCTTTACGAGAAGCTTCACTTCACACCATCAGACATGTAGAGGAAGCCGGAATATTTCCTGGTT
TGCGTGAGGAGTTTGTGGTAGTTGGAGAAAATGAAGCTGATGATAGTTTGGTTTTGAGCTTGCGATCAATTCAGTATGACCTTGCATGGG
AGAGATGCAGGCAGCTTCAAGCTGAAGATGTTGTCATCAAAGGCAAGGTGGTTGGTGCAAATAAAGGTGGAGXTGGTCGCTCTGGTGGAG
GGCCTTCGTGGTXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan