ESTScan Details for Unigene SGN-U270864

Score 
483
Direction 
Reverse
Predicted Peptide Sequence 
FVLHQVLQFEKLLMKMIHSSLLFFVHVIFLRQXLIEVQFLGHGGLYAASTESKATAIPIAPIVESPSSDEDAKQDTNVIAESSDDDKTVQ
AKGRKRAAPRGRGRGSATAAKRGRKPDSSSSSLQRMLMDVNIDDDDDDDDDMTKKEKRPQPRATRNYGAXKEVTVAGTSDTICSIQGC
Predicted Coding Sequence 
XCCTTTGTCCTTCATCAAGTCCTTCAATTTGAGAAGCTTCTCATGAAAATGATTCACAGTAGTCTGCTCTTCTTTGTTCATGTAATTTTC
CTTAGACAGATXCTGATCGAGGTTCAATTCTTGGGTCATGGAGGACTCTATGCTGCTTCCACCGAAAGTAAAGCAACGGCGATTCCTATT
GCACCAATCGTGGAATCTCCTTCAAGTGATGAAGATGCCAAACAGGACACTAACGTTATTGCCGAAAGCTCAGATGATGATAAGACAGTT
CAGGCCAAAGGACGCAAAAGGGCTGCTCCAAGGGGAAGGGGTAGAGGTTCAGCAACAGCGGCTAAAAGGGGAAGAAAACCAGATAGCTCC
TCATCTTCACTTCAAAGGATGCTCATGGATGTTAATATAGATGACGATGATGATGATGATGATGACATGACAAAGAAAGAGAAAAGACCT
CAACCTCGGGCAACTAGGAATTATGGTGCTXTTAAGGAGGTGACCGTAGCTGGAACTTCTGATACCATTTGTTCCATTCAGGGATGTTGA
\
Edits in Original Sequence 
(5')XCCTTTGTCCTTCATCAAGTCCTTCAATTTGAGAAGCTTCTCATGAAAATGATTCACAGTAGTCTGCTCTTCTTTGTTCATGTAAT
TTTCCTTAGACAGATXCTGATCGAGGTTCAATTCTTGGGTCATGGAGGACTCTATGcCTGCTTCCACCGAAAGTAAAGCAACgGGCGATT
CCTATTGCACCAATCGTGGAATCTCCTTCAAGTGATGAAGATGCCAAACAGGACACTAACGTTATTGCCGAAAGCTCAGATGATGATAAG
ACAGTTCAGGCCAAAGGACGCAAAAGGGCTGCTCCAAGGGGAAGGGGTAGAGGTTCAGCAACAGCGGCTAAAAGGGGAAGAAAACCAGAT
AGCTCCTCATCTTCACTTCAAAGGATGCTCATGGATGTTAATATAGATGACGATGATGATGATGATGATGACATGACAAAGAAAGAGAAA
AGACCTCAACCTCGGGCAACTAGGAATTATGGTGCTXTTAAGGAGGTGACCGTAGCTGGAACTTCTGATACCATTTGTTCCATTCAGGGA
TGTTGA\(3')TTATGATGACCAAATTTGCGTAGTGAGTTGTAAATACACTAGTAAGTTACAGAGTGTTTTCGGTTTCAATTGCAGTGGT
TTTTTGTATTTGTCATTGTTGATATGCGAGAGTAGGTCTCGTTTCTTTGAAGTATACATTGATATACCGATGGCTTCAAAATCTAATCCA
ATTTTGGACATTCATTTGCTTTAAAAAAAAAAAAAAAAAACTCGAGGGGGGGCCC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan