ESTScan Details for Unigene SGN-U270956

Score 
513
Direction 
Forward
Predicted Peptide Sequence 
MTPQEERLVLELPPNGEIDGQELPEKYQXRTDNEIKNYWRTHMRKKAQDQRKKSSISPSSSSSSSSITHEENERNFYDTGGIKLLQVEGE
KKSSDQEQHGKSMKVYSMDEIWKDIELLEENEEKMNKPIMGSISPLWDYSLAHFGKILIGVAFDRNVTLN
Predicted Coding Sequence 
ATGACTCCTCAAGAAGAACGTCTTGTTCTTGAACTTCCTCCAAATGGGGAAATAGATGGTCAAGAATTGCCCGAAAAATACCAGXGGCGT
ACTGATAACGAAATTAAGAATTACTGGAGAACCCATATGAGGAAGAAAGCTCAAGACCAGAGGAAAAAGTCTTCTATTTCTCCATCTTCA
TCATCTTCTTCTTCTTCAATCACTCACGAAGAAAATGAAAGAAACTTCTACGATACGGGTGGAATCAAGCTCTTGCAAGTTGAAGGAGAA
AAGAAATCTAGTGATCAAGAACAACATGGAAAAAGTATGAAAGTTTACTCTATGGATGAAATTTGGAAAGATATTGAATTATTAGAAGAA
AATGAAGAAAAAATGAATAAACCAATTATGGGGTCTATTTCACCCCTATGGGATTATTCCCTAGCTCACTTTGGAAAGATTTTGATTGGA
GTAGCTTTCGATAGGAATGTGACTCTGAATTAG\
Edits in Original Sequence 
TATTAGTAGTAGCTAAGAAAAAAAAATGGTGCAAGAAGAAATAATGAGAAGAGGTCCATGGACAGAAGAAGAAGATGTGCAGCTTTTATT
TTATGTTAAATTATTTGGAGATCGACGATGGGATTTTCTTGCTAAAGTTTCAGGTTTGAAACTAAGGTGATTGGCGGGAGACAAATTATA
AAAAAAAAAATACATCATAGTATATATGTATAATATTAGTACAAAAAATAGTCTTCTCTTTTATCCCAAATAACAGTTAAGTTTCTAATC
TCTTCTTTAATTACTTTTAATTTTACTTATTTTAATTTTTTATATATATAGTTGTTTGTGATGTATTTATGTTTATATATGTTTAGGGTT
GAAAAGAACAGGTAAGAGTTGTAGGTTACGTTGGGTTAATTATTTGAATCCTGATCTCAAACATGGAAAG
(5')ATGACTCCTCAAGAAG
AACGTCTTGTTCTTGAACTTCaCTCCAAATGGGGAAATAGATGGTCAAGAATTGCCCGAAAAATACCAGXGGCGTACTGATAACGAAATT
AAGAATTACTGGAGAACCCATATGAGGAAGAAAGCTCAAGACCAGAGGAAAAAGTCTTCTATTTCTCCATCTTCATCATCTTCTTCTTCT
TCAATCACTCACGAAGAAAATGAAAGAAACTTCTACGATACGGGTGGAATCAAGCTCTTGCAAGTTGAAGGAGAAAAGAAATCTAGTGAT
CAAGAACAACATGGAAAAAGTATGAAAGTTTACTCTATGGATGAAATTTGGAAAGATATTGAATTATTAGAAGAAAATGAAGAAAAAATG
AATAAACCAATTATGGGGTCTATTTCACCCCTATGGGATTATTCCCTAGaCTCACTTTGGAAAGATTTTGATTGGAGTAGCTTTCGATAG
GAATGTGACTCTGAATTAG\(3')ACGAGACAACAAACTTCAGATATCAGATGATTAAATTGAGGAGGGAAAAAGACGGGTTAATAGGAG
GTTCATTTATTTGGAAAAAAAAACAAAAACAAAATTGTTATAGTTGGTTTTAGGTTTTACAAGAAAAATATTAAGTTCTAACTTGTATAT
TACTATTAGTAGTGGTGAAAAAAATAAGAAAAAAATCCCATGATTAGAAGGTGCTAGGCCTCTCTTAAGAGGATTAGTAGTAGTGCTTTG
GAATTAAGTCTGTTATTGTAGCCATTTGATGATGCTTTGATTTGATTTCTTGTCTTTTAAGTCCGTTTCAATGTGAAATACTTTCACTAT
CCGGGCAAATCTTTTATCTAGTGTATAC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan