ESTScan Details for Unigene SGN-U271053

Score 
1019
Direction 
Forward
Predicted Peptide Sequence 
CKWSLYDFSVLDKIVPGYFLRRNADGGIENAHAVNNTASEHFMVERLILDDLKCWAVHYKIDGFRFDLMGHIMKRTMLKAKSLLNSLSTE
ENGVDGSSIYIYGEGWDFGEVAKNGRGINASQFNLFGAGIGSFNDRIRDALLGGSPFGHPLHQGFVTGLYLEPNGHDLGDKANVERMLTV
SKDHIQVGMAANLKDFVLTNCDGQEVKGSEVLMYDGKPVGYASSPVETVNYVSAHDNETLFDIISLKTPKDISXGGEMQDEPLSDKCNSP
FSGNTVFPAGDEMLRSKSIDRDSYNSGDWFNRLDFSYNSNNWGVGLPPKEKNERNWPLIKPRLADPSYKPQKSHILAAVENFLNLMQIRY
SSPLFRLKTANAIQERVRFHNTGPSWIPGLIVMSIEDGHQGVPGLSQLDPIYSYIVVIINPCPTDVSFANLALRARSLQLHPVQMNSTDV
VKNSTYDASSGCFNVLPEQLLCLLSLGKIPFALHEKGKPGSVSYARALSLSQFSNIYARYMNCNLLCSVLEKWPWRINK
Predicted Coding Sequence 
TGCAAGTGGTCCCTTTATGACTTCTCTGTTCTAGACAAGATCGTTCCAGGTTACTTTCTAAGGAGAAATGCTGATGGTGGCATTGAAAAT
GCACATGCXGTAAACAATACCGCCAGTGAGCATTTCATGGTTGAGCGCTTAATTCTTGACGACCTCAAGTGCTGGGCAGTTCATTATAAG
ATTGATGGATTTCGGTTTGACCTGATGGGTCACATAATGAAGCGTACAATGTTGAAGGCAAAGTCATTGCTGAATAGCTTGTCAACAGAA
GAAAATGGTGTGGATGGATCAAGTATTTATATATATGGTGAAGGATGGGATTTTGGTGAAGTGGCAAAGAACGGACGTGGGATAAATGCA
TCACAATTCAACCTTTTTGGAGCTGGAATTGGGAGCTTCAATGATCGTATTCGGGATGCTTTACTGGGTGGATCACCTTTTGGTCATCCT
CTACATCAAGGTTTTGTAACTGGCCTTTATTTGGAGCCTAACGGTCATGATCTTGGTGATAAAGCCAATGTAGAACGTATGCTTACTGTG
TCGAAGGATCACATTCAGGTTGGCATGGCTGCAAACTTGAAGGATTTTGTGCTAACGAACTGTGATGGTCAAGAGGTGAAAGGATCTGAA
GTGCTAATGTATGACGGGAAGCCAGTTGGATATGCTTCTTCTCCTGTTGAAACAGTTAACTACGTGTCTGCTCATGACAATGAGACACTG
TTTGACATCATTAGTCTTAAGACTCCAAAGGACATTTCTGXTGGAGGAGAGATGCAGGATGAACCACTTAGCGACAAGTGTAATAGCCCT
TTCTCAGGGAATACCGTTTTTCCAGCTGGAGATGAAATGCTGCGCTCAAAATCGATAGACCGTGACTCCTACAACTCTGGTGATTGGTTC
AACAGGCTGGACTTTAGCTACAACTCTAACAACTGGGGTGTTGGCCTCCCTCCGAAAGAAAAGAATGAAAGAAACTGGCCACTAATCAAA
CCAAGACTAGCAGATCCATCCTACAAGCCTCAGAAGAGTCATATCCTTGCAGCTGTTGAAAACTTTTTGAATCTAATGCAAATACGATAC
TCCTCACCACTCTTCCGGTTAAAGACGGCCAATGCTATCCAGGAAAGAGTACGATTTCATAATACTGGTCCTTCATGGATTCCTGGACTT
ATAGTAATGAGCATTGAAGATGGCCACCAGGGAGTTCCAGGGCTCTCTCAATTGGATCCAATTTATTCCTATATAGTTGTCATCATCAAT
CCTTGCCCGACTGATGTCTCATTTGCCAATCTTGCACTTAGAGCAAGATCTCTTCAGTTGCATCCAGTACAGATGAACTCAACTGACGTT
GTTAAGAACTCAACATATGATGCATCCTCGGGTTGCTTTAACGTGCTGCCCGAACAACTTCTGTGTTTGTTGAGCCTCGGTAAAATTCCG
TTTGCTCTTCATGAAAAGGGXAAACCTGGATCGGTGAGTTATGCTCGTGCATTATCACTTTCACAGTTCAGCAACATTTACGCAAGGTAC
ATGAACTGTAACTTGTTATGTTCAGTTCTAGAAAAATGGCCCTGGAGAATCAATAAATAA\
Edits in Original Sequence 
(5')TGCAAGTGGTCCCTTTATGACTTCTCTGTTCTAGACAAGATCGTTCCAGGTTACTTTCTAAGGAGAAATGCTGATGGTGGCATTGA
AAATaGCACATGCXGTAAACAATACCGCCAGTGAGCATTTCATGGTTGAGCGCTTAATTCTTGACGACCTCAAGTGCTGGGCAGTTCATT
ATAAGATTGATGGATTTCGGTTTGACCTGATGGGTCACATAATGAAGCGTACAATGTTGAAGGCAAAGTCATTGCTGAATAGCTTGTCAA
CAGAAGAAAATGGTGTGGATGGATCAAGTATTTATATATATGGTGAAGGATGGGATTTTGGTGAAGTGGCAAAGAACGGACGTGGGATAA
ATGCATCACAATTCAACCTTTTTGGAGCTGGAATTGGGAGCTTCAATGATCGTATTCGGGATGCTTTACTGGGTGGATCACCTTTTGGTC
ATCCTCTACATCAAGGTTTTGTAACTGGCCTTTATTTGGAGCCTAACGGTCATGATCTTGGTGATAAAGCCAATGTAGAACGTATGCTTA
CTGTGTCGAAGGATCACATTCAGGTTGGCATGGCTGCAAACTTGAAGGATTTTGTGCTAACGAACTGTGATGGTCAAGAGGTGAAAGGAT
CTGAAGTGCTAATGTATGACGGGAAGCCAGTTGGATATGCTTCTTCTCCTGTTGAAACAGTTAACTACGTGTCTGCTCATGACAATGAGA
CACTGTTTGACATCATTAGTCTTAAGACTCCAAAGGACATTTCTGXTGGAGGAGAGATGCAGGATGAACCACTTAGCGACAAGTGTAATA
GCCCTTTCTCAGGGAATACCGTTTTTCCAcGCTGGAGATGAAATGCTGCGCTCAAAATCGATAGACCGTGACTCCTACAACTCTGGTGAT
TGGTTCAACAGGCTGGACTTTAGCTACAACTCTAACAACTGGGGTGTTGGCCTCCCTCCGAAAGAAAAGAATGAAAGAAACTGGCCACTA
ATCAAACCAAGACTAGCAGATCCATCCTACAAGCCTCAGAAGAGTCATATCCTTGCAGCTGTTGAAAACTTTTTGAATCTAATGCAAATA
CGATACTCCTCACCACTCTTCCGGTTAAAGACGGCCAATGCTATCCAGGAAAGAGTACGATTTCATAATACTGGTCCTTCATGGATTCCT
GGACTTATAGTAATGAGCATTGAAGATGGCCACCAGGGAGTTCCAGGGCTCTCTCAATTGGATCCAATTTATTCCTATATAGTTGTCATC
ATCAATCCTTGCCCGACTGATGTCTCATTTGCCAATCTTGCACTTAGAGCAAGATCTCTTCAGTTGCATCCAGTACAGATGAACTCAACT
GACGTTGTTAAGAACTCAACATATGATGCATCCTCGGGTTGCTTTAACGTGcCTGCCCGAACAACTTCTGTGTTTGTTGAGCCTCGGTAA
AATTCCGTTTGCTCTTCATGAAAAGGGXAAACCTGGATCGGTGAGTTATGCTCGTGCATTATCACTTTCACAGTTCAGCAACATTTACGC
AAGGTACATGAACTGTAACTTGTTATGTTCAGTTCTAGAAAAATGGCCCTGGAGAATCAATAAATAA\(3')ATATACCACAAAAATAAT
CCCAGTTCTCTGTTTATTCAACAGGAAGTTGCCAGAAAAATGATTTATGTTTTATTATTAAGTTGATAATAATCAGAGAGAATTAATAAG
TTAAATATTTGTGTAATACTAGTGTGTTAAATTCAAATATGTTATTCTAGTTGTTTAAGTTCTTAGTTTGTGTCAAATTTTAAGAGTCAA
CTTGTCAGATTTCCATGTCGGTCATTTTAGATAAGAGACTTCGGGTGTCGTTTGGAGGAGTGTAGAAGAATAGTACCTAGTAGATGATAA
TATATTCAGGTCTAATAAATTTTTCTTAGACAAAACATTTAAATTTTTATTTTTTTAATCAATGATGATGGTGAGACGTGAATGTAGTAT
CTCTATTTGTTTTAATA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan