ESTScan Details for Unigene SGN-U271063

Score 
1335
Direction 
Forward
Predicted Peptide Sequence 
MSLSGKGTPTSDKKLTLAKATSLNPNAAEFVPFALRSPSGSTSSTDASKFANSTTTLGKAVLDRSESSASNNSDDEAHQYWRRQLPDDIT
PDFNVMGEDDSHGISSLPFSRLSVTDVNEASLFPASTGSSFMLKDQQELSLVXINGSSFVEKTGYPITSFGEDASSTSFHLPSKPWDKPS
LTNDQPFANIREGPHYNGNSGNSFFADMMNEPPFFEADVNPLEFLASQFPGFAAESLGEVYYANGGDLNLTIEMLTQLELQVDGGFNQNM
NSKALSAPNLSALDFPALSVAESQNSSLKYSGSDAQQNVNPYRPSEKESTLLFRSGSSIPFRGATDFASAVRKMASQDSSIWKYDRTGVA
DGSVGSSRNSPVLASSYNGGQSRGVYGDRLQSRGSTRAAPVWLETGEAVANIYSEMREEARDHARLRNAYFEQARQAYLIGNKALAKELS
VKGQLHNMQMKAAHGKAQESIYRLRNPEMQGNGRGQERIIDLHGLHVTEAIHVLKRELSVLRNAARSADQQYRFIFALEQDIIQRVRXTP
ARLPISVQRYLLEEGLDYSEPQPGLLRVVIY
Predicted Coding Sequence 
ATGAGCTTATCAGGAAAAGGGACTCCAACCAGTGACAAAAAGCTAACCTTAGCAAAAGCGACAAGCTTGAATCCAAATGCTGCAGAATTT
GTACCCTTTGCACTCAGATCACCCTCAGGTAGCACTAGCAGCACCGATGCATCAAAGTTCGCTAACTCCACTACTACTTTGGGAAAAGCT
GTACTAGATAGATCAGAATCATCTGCTTCGAACAACTCAGATGATGAAGCTCACCAGTATTGGCGTCGCCAGCTCCCGGATGATATTACA
CCGGACTTCAATGTCATGGGGGAAGATGATTCTCATGGAATCAGCAGTCTTCCATTTTCTAGATTATCAGTAACTGATGTCAATGAAGCT
TCATTATTCCCTGCCTCAACTGGCAGTAGCTTCATGTTGAAGGACCAGCAGGAGTTATCTCTAGTCGXCATTAATGGTAGTAGTTTTGTT
GAAAAGACAGGATATCCTATTACATCTTTTGGCGAAGATGCTTCCTCAACTAGTTTTCATCTGCCTTCTAAACCCTGGGATAAGCCATCG
CTGACCAATGACCAGCCTTTTGCCAATATTAGGGAGGGGCCTCATTATAATGGGAATTCAGGAAACAGCTTCTTTGCAGACATGATGAAC
GAGCCACCATTTTTTGAAGCAGATGTAAACCCTCTTGAATTTTTAGCCTCTCAATTTCCTGGTTTTGCTGCTGAAAGTCTTGGAGAGGTG
TACTATGCCAATGGAGGTGACTTGAATCTGACAATTGAAATGCTTACTCAGCTTGAGCTTCAAGTTGATGGTGGGTTTAATCAAAATATG
AATTCAAAAGCCTTGTCTGCTCCAAATCTTAGTGCTCTGGATTTCCCTGCTCTTTCTGTGGCGGAAAGTCAAAACAGCAGCCTAAAGTAC
TCTGGCAGTGATGCTCAACAAAATGTCAATCCCTATAGGCCTTCTGAAAAAGAGAGCACCCTTCTGTTTAGATCTGGCTCTTCCATCCCT
TTTCGAGGTGCTACAGATTTTGCATCTGCTGTCAGGAAGATGGCATCTCAGGATTCTAGCATATGGAAGTATGATAGGACTGGAGTAGCT
GATGGTAGTGTTGGATCAAGTAGAAATTCACCTGTATTGGCTAGCTCTTACAATGGTGGGCAGAGTAGGGGAGTTTATGGTGATAGGTTG
CAGAGCCGAGGTTCCACACGTGCAGCTCCTGTCTGGCTTGAAACTGGAGAAGCAGTTGCAAATATATATTCTGAAATGCGGGAAGAGGCT
CGTGACCATGCACGCTTACGTAATGCATACTTTGAACAGGCACGTCAGGCATATCTTATTGGTAACAAGGCTTTGGCCAAAGAACTGAGC
GTCAAGGGACAGCTTCACAACATGCAGATGAAGGCAGCTCATGGGAAGGCTCAAGAATCTATATATCGCCTAAGGAATCCAGAGATGCAG
GGAAATGGGAGAGGACAAGAGAGAATCATAGATCTGCATGGTCTTCATGTTACTGAGGCCATTCATGTCCTTAAGCGTGAGCTGTCTGTG
TTGAGGAATGCTGCCAGATCAGCAGACCAGCAATACAGGTTTATATTTGCGTTGGAACAGGACATCATACAAAGGGTTCGCGXTACTCCT
GCTAGGCTTCCCATTTCTGTCCAGCGTTACCTGCTAGAGGAGGGCCTTGACTACTCTGAGCCACAACCAGGGCTTCTCCGAGTTGTGATA
TACTGA\
Edits in Original Sequence 
TTTTTATTTTTTTTTTTTTCCTTTTTTATTTGAATAATATAAGGTGGTATTATTAGGATTGGTTTGGTTGAAACATAGATTCATGGTGTG
CCATCTTATAATTAGAAGTTTCATGATGTATGTAGAGACCCTTTTTTCTTAACCATCTAGAAACAAGACAAAAAGAAAAAAAATAACGAA
GAAAAAAGA
(5')ATGAGCTTATCAGGAAAAGGGACTCCAACCAGTGACAAAAAGCTAACCTTAGCAAAAGCGACAAGCTTGAATCCAAA
TGCTGCAGAATTTGTACCCTTTGCACTCAGATCACCCTCAGGTAGCACTAGCAGCACCGATGCATCAAAGTTCGCTAACTCCACTACTAC
TTTGGGAAAAGCTGTACTAGATAGATCAGAATCATCTGCTTCGAACAACTCAGATGATGAAGCTCACCAGTATTGGCGTCGCCAGCTCCC
GGATGATATTACACCGGACTTCAATGTCATGGGGGAAGATGATTCTCATGGAATCAGCAGTCTTCCATTTTCTAGATTATCAGTAACTGA
TGTCAATGAAGCTTCATTATTCCCTGCCTCAACTGGCAGTAGCTTCATGTTGAAGGACCAGCAGGAGTTATCTcCTAGTCGXCATTAATG
GTAGTAGTTTTGTTGAAAAGACAGGATATCCTATTACATCTTTTGGCGAAGATGCTTCCTCAACTAGTTTTCATCTGCCTTCTAAACCCT
GGGATAAGCCATCGCTGACCAATGACCAGCCTTTTGCCAATATTAGGGAGGGGCCTCATTATAATGGGAATTCAGGAAACAGCTTCTTTG
CAGACATGATGAACGAGCCACCATTTTTTGAAGCAGATGTAAACCCTCTTGAATTTTTAGCCTCTCAATTTCCTGGTTTTGCTGCTGAAA
GTCTTGGAGAGGTGTACTATGCCAATGGAGGTGACTTGAATCTGACAATTGAAATGCTTACTCAGCTTGAGCTTCAAGTTGATGGTGGGT
TTAATCAAAATATGAATTCAAAAGCCTTGTCTGCTCCAAATCTTAGTGCTCTGGATTTCCCTGCTCTTTCTGTGGCGGAAAGTCAAAACA
GCAGCCTAAAGTACTCTGGCAGTGATGCTCAACAAAATGTCAATCCCTATAGGCCTTCTGAAAAAGAGAGCACCCTTCTGTTTAGATCTG
GCTCTTCCATCCCTTTTCGAGGTGCTACAGATTTTGCATCTGCTGTCAGGAAGATGGCATCTCAGGATTCTAGCATATGGAAGTATGATA
GGACTGGAGTAGCTGATGGTAGTGTTGGATCAAGTAGAAATTCACCTGTATTGGCTAGCTCTTACAATGGTGGGCAGAGTAGGGGAGTTT
ATGGTGATAGGTTGCAGAGCCGAGGTTCCACACGTGCAGCTCCTGTCTGGCTTGAAACTGGAGAAGCAGTTGCAAATATATATTCTGAAA
TGCGGGAAGAGGCTCGTGACCATGCACGCTTACGTAATGCATACTTTGAACAGGCACGTCAGGCATATCTTATTGGTAACAAGGCTTTGG
CCAAAGAACTGAGCGTCAAGGGACAGCTTCACAACATGCAGATGAAGGCAGCTCATGGGAAGGCTCAAGAATCTATATATCGCCTAAGGA
ATCCAGAGATGCAGGGAAATGGGAGAGGACAAGAGAGAATCATAGATCTGCATGGTCTTCATGTTACTGAGGCCATTCATGTCCTTAAGC
GTGAGCTGTCTGTGTTGAGGAATGCTGCCAGATCAGCAGACCAGCgAATACAGGTTTATATTTGCGTTGGAACAGGACATCATACAAAGG
GTTCGCGXTACTCCTGCTAGGCTTCCCATTTCTGTCCAGCGTTACCTGCTAGAGGAGGGCCTTGACTACTCTGAGCCACAACCAGGGCTT
CTCCGAGTTGTGATATACTGA\(3')GGTGTGAAGGTATAGGAGTTTTTGACACGTCATTATCCTAGAAAATCCATCAGATGAAGAAAAA
GAAAAAAAGAAAATTGTTGTACCTGTAAATGGGGGGAACGGAAGGTTAGTGCAAATTCTGGAAAGGGAAAATGAAAATGTGAAAAAAAGT
GGAAGAAAATTGTATCATTTAAGGTTTAGTTGTTGGATAGGAGGATACGTTTTGTAGCTTGCGGGGACTTGCATCGGCCCCCTTCGATTT
TGTAACGTTGGTTCTTTCTCACATTCCTTTTCATTTTGATTAGCCGATGTAACTGATAGAATTCTTTCACGTGAAAGCTGAAATTCACCA
AGTGTTTTGGGCCTCAGTTGTTTTCATTAAGATTCAGACGTTTGAATCTGAGTAAGCATTTGAATATTAAGATCTAGGTGTTTTAATCTG
GCTAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan