ESTScan Details for Unigene SGN-U271065

Score 
755
Direction 
Forward
Predicted Peptide Sequence 
MDYDPSDEKEAIDDTKAGVKGLVDSGIVEIPRIFIRPPHELAEELNMCKSTLQVPVVDLSGIEVEDRRKIIVDEIREVSEKLGLFQVINH
GVPSSVLEGMIDGTRKFHEQDVEVKKEYYSSDPTTRRVRYDGNVHVYKTKGKTAHWKDTLYVAGLVSGHIEPEELPEVCRKEYVEYTNHV
DKLGEILFGILSEGLGLKPDQLKDTECAKEQGMACHYYPTCPQXELTLGTGKH
Predicted Coding Sequence 
ATGGATTATGATCCATCGGATGAGAAAGAGGCTATTGATGATACAAAAGCTGGCGTTAAGGGACTAGTTGATTCTGGAATAGTCGAGATT
CCAAGAATTTTCATCAGGCCACCTCATGAACTTGCTGAGGAGTTGAATATGTGCAAGTCAACTCTACAGGTTCCGGTGGTGGATCTAAGT
GGCATAGAAGTTGAAGATCGGCGTAAGATCATTGTTGATGAAATAAGGGAAGTATCTGAGAAATTGGGCCTTTTCCAAGTGATAAATCAT
GGGGTTCCTTCAAGTGTTTTGGAAGGAATGATTGATGGGACTCGAAAATTTCATGAACAAGATGTCGAAGTGAAGAAAGAGTACTATTCG
TCTGATCCAACAACCAGACGAGTTAGATATGATGGCAATGTTCATGTGTACAAAACAAAAGGAAAGACTGCACACTGGAAGGATACATTG
TATGTTGCTGGGCTAGTTTCTGGTCACATTGAACCTGAAGAATTACCAGAAGTTTGCAGGAAGGAATACGTTGAGTACACAAATCATGTC
GATAAACTAGGGGAAATTCTTTTTGGCATACTATCAGAAGGTCTTGGGCTAAAACCTGATCAGTTGAAAGATACAGAATGTGCCAAAGAA
CAAGGGATGGCATGCCATTACTACCCGACATGCCCACAGNCAGAGCTAACTCTTGGTACTGGTAAGCAT\
Edits in Original Sequence 
GTAAACTTTCTCAAGTTGAATTTAGCA(5')ATGGATTATGATCCATCGGATGAGAAAGAGGCTATTGATGATACAAAAGCTGGCGTTAA
GGGACTAGTTGATTCTGGAATAGTCGAGATTCCAAGAATTTTCATCAGGCCACCTCATGAACTTGCTGAGGAGTTGAATATGTGCAAGTC
AACTCTACAGGTTCCGGTGGTGGATCTAAGTGGCATAGAAGTTGAAGATCGGCGTAAGATCATTGTTGATGAAATAAGGGAAGTATCTGA
GAAATTGGGCCTTTTCCAAGTGATAAATCATGGGGTTCCTTCAAGTGTTTTGGAAGGAATGATTGATGGGACTCGAAAATTTCATGAACA
AGATGTCGAAGTGAAGAAAGAGTACTATTCGTCTGATCCAACAACCAGACGAGTTAGATATGATGGCAATGTTCATGTGTACAAAACAAA
AGGAAAGACTGCACACTGGAAGGATACATTGTATGTTGCTGGGCTAGTTTCTGGTCACATTGAACCTGAAGAATTACCAGAAGTTTGCAG
GAAGGAATACGTTGAGTACACAAATCATGTCGATAAACTAGGGGAAATTCTTTTTGGCATACTATCAGAAGGTCTTGGGCTAAAACCTGA
TCAGTTGAAAGATACAGAATGTGCCAAAGAACAAGGGATGGCATGCCATTACTACCCGACATGCCCACAGNCAGAGCTAACTCTTGGTAC
TGGTAAGCAT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan