ESTScan Details for Unigene SGN-U271089

Score 
757
Direction 
Forward
Predicted Peptide Sequence 
LNLFLCPTVAMPQGDYIELHRKRFGRRPDHFERKRKKDAREVHKRSQIAQKALGIKGKMFAKKRYAEKAQMKKTLAMHEESSSRRKVDDD
VHEGAVPAYLMDRETTTRAKILSNTIKQKRKEKAGKWEVPLPKVRPVAEDEMFRVIRSGKRKTKQWKRMVTKATFVGAGFTRKPPKYERF
IRPSGLRFTKAHVTHPELKCTFNLEIIGVKKNPNGPMYTSLGVITKGTIIEVNVSELGLVTPAGKVVWGKYAQVTNNPENDGCIKEFSX
Predicted Coding Sequence 
XCTCTCAATCTCTTTCTCTGTCCTACCGTAGCCATGCCTCAGGGAGATTACATAGAGTTGCACAGGAAGAGATTTGGGCGTCGCCCTGAT
CACTTCGAGCGTAAACGTAAGAAGGATGCTCGTGAAGTTCACAAGCGATCCCAAATTGCCCAAAAGGCTTTGGGTATCAAGGGTAAGATG
TTTGCTAAGAAGCGGTATGCTGAGAAGGCCCAAATGAAGAAAACATTGGCTATGCATGAAGAGTCATCATCCCGGCGCAAGGTTGATGAT
GATGTGCATGAGGGAGCTGTCCCTGCATATCTGATGGATCGTGAGACTACCACAAGAGCTAAGATTCTTAGCAACACAATAAAGCAAAAG
AGGAAAGAGAAAGCTGGAAAATGGGAGGTGCCTCTACCTAAGGTTAGGCCTGTGGCTGAGGATGAGATGTTCAGAGTGATAAGATCTGGC
AAAAGGAAGACCAAGCAGTGGAAGAGAATGGTTACAAAAGCAACCTTTGTCGGAGCAGGGTTTACCAGGAAACCTCCAAAGTATGAGCGG
TTCATCCGCCCATCTGGCTTACGGTTTACTAAAGCCCACGTGACACACCCTGAACTTAAATGTACGTTCAATCTTGAGATCATTGGGGTG
AAGAAGAATCCTAATGGTCCAATGTATACTTCTCTAGGTGTTATAACCAAGGGAACCATCATTGAGGTTAATGTCAGTGAACTTGGTCTT
GTCACTCCTGCTGGGAAAGTTGTATGGGGTAAATATGCTCAAGTGACGAATAATCCTGAAAATGATGGTTGCATCAAGGAGTTCTCCTAN
\
Edits in Original Sequence 
(5')XCTCTCAATCTCTTTCTCTGTCCTACCGTAGCCATGCCTCAGGGAGATTACATAGAGTTGCACAGGAAGAGATTTGGGCGTCGCCC
TGATCACTTCGAGCGTAAACGTAAGAAGGATGCTCGTGAAGTTCACAAGCGATCCCAAATTGCCCAAAAGGCTTTGGGTATCAAGGGTAA
GATGTTTGCTAAGAAGCGGTATGCTGAGAAGGCCCAAATGAAGAAAACATTGGCTATGCATGAAGAGTCATCATCCCGGCGCAAGGTTGA
TGATGATGTGCATGAGGGAGCTGTCCCTGCATATCTGATGGATCGTGAGACTACCACAAGAGCTAAGATTCTTAGCAACACAATAAAGCA
AAAGAGGAAAGAGAAAGCTGGAAAATGGGAGGTGCCTCTACCTAAGGTTAGGCCTGTGGCTGAGGATGAGATGTTCAGAGTGATAAGATC
TGGCAAAAGGAAGACCAAGCAGTGGAAGAGAATGGTTACAAAAGCAACCTTTGTCGGAGCAGGGTTTACCAGGAAACCTCCAAAGTATGA
GCGGTTCATCCGCCCATCTGGCTTACGGTTTACTAAAGCCCACGTGACACACCCTGAACTTAAATGTACGTTCAATCTTGAGATCATTGG
GGTGAAGAAGAATCCTAATGGTCCAATGTATACTTCTCTAGGTGTTATAACCAAGGGAACCATCATTGAGGTTAATGTCAGTGAACTTGG
TCTTGTCACTCCTGCTGGGAAAGTTGTATGGGGTAAATATGCTCAAGTGACGAATAATCCTGAAAATGATGGTTGCATCAAtGGAGTTCT
CCTAN\(3')GTGTAATACTTTTTAACAGAGAAGAAACTGCACCTTTTTTTGTTTGAATAGAGTGCATAACTATATGTATCTCTTCGGTA
TTGCTCGACTCTGGTTGCGACAGAGTTGTAGAACAGGAGAGGTGAAATGAAGTAGTTATTTGTTGGTACTTGCAACTGTACCGATAAAAA
AAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan