ESTScan Details for Unigene SGN-U271134

Score 
703
Direction 
Forward
Predicted Peptide Sequence 
MDESATPWSIVESKEQDICLGXLTQRKEGTNILVAHCSCYYSTHDNXVQGYEGAREITAASKAXPKFKKAIMFMSAYSVNTLCNKISTAY
CPSLKRMAAIPLFHQGVTVASSYQEQESEXPSVTEVSCLTLVITGVVDMSLQRQRLNSLVFVCAWDXDVHSTYTRPRRLIVRQNSHIFFT
DALNLHGYLTLPDKEEIADEFAGEKWRLFSDFSAYPLRISHFPAIFFLIFRPVNNSPAISPTIFHRKVKPKEGIWVVKLKKVEMGHFSSM
FNGLARSFSLKKRKNSSGNGKYDGRDAVEAMAKEAKRNDLILRSSGTVNVDGSKNFASLFSRRGEKGVNQDCFIVWEEFGCQQDMAFCGI
FDGHGPWGHFVSEAGSGIDSIIVALHLAGELAEASADPDLDKKDQRFNIWKESFLKACATVDQELEHHPKIDTFYSGTTALTIVRQGEVL
FVANVGDSRAVLATTCDDGNLVPVQLTVDFKPNLPQETERILQCNGRVFCLDDESGVHRLWLPDESSPGLAMSRAFGDYCVKDFGLISVP
DVTQRHITSKDQFVVLATDGVWDVISNEEAVEIVSETPDRAKAAKHLVQCAVRAW
Predicted Coding Sequence 
ATGGATGAATCAGCAACCCCATGGTCAATAGTAGAAAGCAAGGAACAGGACATTTGCCTCGGTAXATTAACTCAAAGAAAAGAAGGTACT
AACATACTTGTAGCTCATTGCAGTTGTTACTATAGCACACATGACAATGXTGTTCAAGGGTATGAAGGAGCAAGAGAAATAACAGCAGCA
AGCAAAGCTGXACCAAAGTTCAAGAAAGCAATAATGTTTATGAGTGCCTATAGTGTXAACACTCTTTGCAACAAAATTTCTACTGCTTAC
TGTCCGTCCTTGAAGAGAATGGCAGCTATCCCCCTTTTCCACCAAGGTGTCACAGTTGCCTCATCTTACCAGGAACAAGAGAGTGAAXTA
CCTTCGGTAACTGAAGTATCCTGCTTGACCCTCGTCATCACAGGCGTAGTTGATATGAGCCTTCAGAGGCAAAGGTTGAATAGCCTTGTC
TTTGTTTGTGCTTGGGATXTAGATGTACATAGCACATATACCCGCCCGCGCCGCTTGATTGTGCGACAGAACTCGCACATCTTCTTCACT
GATGCCCTXAACCTTCATGGCTACCTGACTTTGCCGGATAAAGAAGAGATCGCCGATGAGTTCGCCGGAGAGAAATGGAGACTTTTCTCT
GATTTCTCAGCTTACCCACTTCGAATTTCTCATTTTCCGGCAATCTTTTTTCTGATTTTCCGACCTGTCAATAACTCTCCGGCCATTTCT
CCGACCATATTCCACCGGAAAGTTAAACCAAAGGAGGGTATTTGGGTAGTTAAATTAAAGAAGGTTGAAATGGGGCATTTTTCTTCAATG
TTTAATGGATTAGCAAGGTCTTTTTCCTTGAAGAAAAGAAAGAATAGTTCTGGAAATGGGAAATATGATGGTAGAGATGCTGTTGAGGCT
ATGGCTAAAGAAGCCAAGAGAAATGACTTGATATTAAGGTCTTCAGGGACTGTAAATGTTGATGGTTCTAAGAATTTTGCTTCATTATTC
TCAAGGAGGGGTGAAAAAGGCGTAAATCAAGATTGCTTCATTGTTTGGGAGGAATTTGGATGCCAACAAGACATGGCATTCTGTGGTATA
TTTGATGGGCATGGTCCTTGGGGTCATTTTGTGTCXGAAGCAGGTTCGGGAATCGATAGTATCATCGTTGCTTTGCATTTGGCAGGAGAG
CTAGCTGAGGCTTCAGCTGATCCAGATTTGGATAAAAAGGATCAAAGGTTTAACATATGGAAAGAGTCCTTCTTAAAGGCATGTGCAACT
GTGGATCAGGAGCTGGAACACCATCCCAAAATTGATACATTTTACAGTGGAACCACTGCTTTGACAATAGTCAGACAGGGTGAGGTTTTA
TTTGTAGCAAATGTTGGCGACTCACGTGCAGTATTAGCTACCACTTGCGATGATGGCAACTTGGTACCAGTTCAGCTCACTGTTGATTTC
AAGCCTAATCTACCTCAGGAAACTGAGAGAATACTGCAATGTAATGGTAGAGTATTTTGCTTAGATGATGAATCTGGGGTGCACCGATTA
TGGCTGCCCGATGAATCCTCCCCTGGATTGGCAATGTCTAGAGCCTTCGGGGACTATTGCGTGAAAGATTTTGGTCTAATTTCAGTGCCT
GACGTGACTCAAAGGCATATCACAAGCAAAGACCAATTTGTTGTGCTGGCAACAGATGGGGTATGGGATGTTATATCGAATGAAGAGGCT
GTAGAAATTGTATCTGAAACTCCAGATAGGGCAAAAGCAGCCAAGCATCTTGTTCAATGTGCTGTTCGTGCTTGG\
Edits in Original Sequence 
TTTTTTTTTTTTTTTTTTTTTTTTTTTATTTTTTTTTTTTTTTTTTCAAGGAAAAACAGAACATTCCATAGAAAGTAAAGAAATTTGAAT
CATACTTTTTTTCTCTTCTCCA
(5')ATGGATGAATCAGCAACCCCATGGTCAATAGTAGAAAGCAAGGAACAGGACATTTGCCTCGGTA
XATTAACTCAAAGAAAAGAAGGTACTAACATACTTGTAGCTCATTGCAGTTGTTACTATAGCACACATGACAATGXTGTTCAAGGGTATG
AAGGAGCAAGAGAAATAACAGCAGCAAGCAAAGCTGXACCAAAGTTCAAGAAAGCAATAATGTTTATGAGTGCCTATAGTGTXAACACTC
TTTGCAACAAAATTTCTACTGCTTACTGTCCGTCCTTGAAGAGAATGGCAGCTATCCCCCTTTTCCACCAAGGTGTCACAGTTGCCTCgA
TCTTACCAGGAACAAGAGAGTGAAXTACCTTCGGTAACTGAAGTATCCTGCTTGACCCTCGTCATCACAGGCGTAGTTGATATGAgGCCT
TCAGAGGCAAAGGTTGAATAGCCTTGTCTTTGTTTGTGCTTGGGATXTAGATGTACATAGCACATATACCCGCCCGCGCCGCTTGATTGT
GCGACAGAACTCGCACATCTTCTTCACTGATGCCCTXAACCTTCATGGCTACCTGACTTTGCCGGATAAAGAcAGAGATCGCCGATGAGT
TCGCCGGAGAGAAATGGAGACTTTTCTCTcGATTTCTCAGCTTACCCACTTCGAATTTCgTCATTTTCCGGCAATCTTTTTTCTGATTTT
CCGACCTGTCAATAACTCTCCGGCCATTTCTCCGACCATATTCCACCGGAAAGTTAAACCAAAGGAGGGTATTTGGGTAGTTAAATTAAA
GaAAGGTTGAAATGGGGCATTTTTCTTCAATGTTTAATGGATTAGCAAGGTCTTTTTCCTTGAAGAAAAGAAAGAATAGTTCTGGAAATG
GGAAATATGATGGTAGAGATGCTGTTGAGGCTATGGCTAAAGAAGCCAAGAGAAATGACTTGATATTAAGGTCTTCAGGGACTGTAAATG
TTGATGGTTCTAAGAATTTTGCTTCATTATTCTCAAGGAGGGGTGAAAAAGGCGTAAATCAAGATTGCTTCATTGTTTGGGAGGAATTTG
GATGCCAACAAGACATGGCATTCTGTGGTATATTTGATGGGCATGGTCCTTGGGGTCATTTTGTGTCXGAAGCAGGTTCGGGAATCGATA
GTATCATCGTTGCTTTGCATTTGGCAGGAGAGtCTAGCTGAGGCTTCAGCTGATCCAGATTTGGATAAAAAGGATCAAAGGTTTAACATA
TGGAAAGAGTCCTTCTTAAAGGCATGTGCAACTGTGGATCAGGAGCTGGAACACCATCCCAAAATTGATACATTTTACAGTGGAACCACT
GCTTTGACAATAGTCAGACAGGGTGAGGTTTTATTTGTAGCAAATGTTGGCGACTCACGTGCAGTATTAGCTACCACTTGCGATGATGGC
AACTTGGTACCAGTTCAGCTCACTGTTGATTTCAAGCCTAATCTACCTCAGGAAACTGAGAGAATACTGCAATGTAATGGTAGAGTATTT
TGCTTAGATGATGAATCTGGGGTGCACCGATTATGGCTGCCCGATGAATCCTCCCCTGGATTGGCAATGTCTAGAGCCTTCGGGGACTAT
TGCGTGAAAGATTTTGGTCTAATTTCAGTGCCTGACGTGACTCAAAGGCATATCACAAGCAAAGACCAATTTGTTGTGCTGGCAACAGAT
GGGGTATGGGATGTTATATCGAATGAAGAGGCTGTAGAAATTGTATCTGAAACTCCAGATAGGGCAAAAGCAGCCAAGCATCTTGTTCAA
TGTGCTGTTCGTGCTTGG\(3')AAACGTAAGAGGAGAGGGATAGCTGTAGATGATATTTCAGCAATTGTACTCTTCTTTCATTCTAAGC
ATTTCTGTCAGCATATTTACCCTGTAACTACTCCAAAATAACACTTGATAGAAAACGCAAGTTTCTGTCTCTAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan