ESTScan Details for Unigene SGN-U271158

Score 
534
Direction 
Forward
Predicted Peptide Sequence 
LRRRRFTLLRFRLENYRHLKKYQRTAKNVSERIDGAGPEKLDVTKLHPLSPEVISRQATINIGTIGHVAHGKSTVVKAISGVQTVRFKNE
LERNITIKLGYANAKIYKCEEDRCPRPMCYKAYGSGKEDGPMCDVPGFETCRMKLLRHVSFVDCPGHDILMATMLNGAAIMDGALLLIAA
NESCPQPQTSEHLAAVEIMXPXTHNNSPNRVDLVQENVAINQHEAIQKFIRXTVADGAPVVPISA
Predicted Coding Sequence 
CTGCGACGCCGCCGTTTCACTCTTCTCCGTTTCAGACTTGAAAATTACCGACATCTGAAGAAGTATCAAAGAACAGCTAAAAATGTCTCG
GAAAGGATTGATGGAGCAGGACCTGAGAAGTTGGATGTAACAAAGTTGCATCCACTTTCACCAGAGGTTATTTCTCGTCAGGCTACAATA
AATATTGGTACCATTGGGCATGTGGCTCATGGGAAGTCAACAGTTGTAAAAGCTATATCTGGAGTGCAGACTGTTCGTTTTAAAAATGAG
CTAGAAAGAAACATCACAATTAAGCTTGGATATGCTAATGCTAAGATATATAAATGTGAAGAAGACCGCTGCCCTAGACCCATGTGCTAC
AAGGCATATGGAAGTGGAAAAGAAGACGGTCCCATGTGTGATGTCCCCGGTTTCGAGACCTGTAGGATGAAATTGCTGAGACATGTATCT
TTCGTTGATTGCCCCGGTCATGATATTCTCATGGCTACTATGCTTAATGGAGCTGCAATTATGGATGGAGCATTACTTCTAATTGCTGCT
AATGAGAGCTGTCCCCAACCTCAGACTTCTGAACATTTAGCTGCTGTAGAAATTATGCXGCCTNCAACACATAATAATTCTCCAAATAGG
GTTGATCTAGTTCAGGAAAATGTTGCCATTAACCAGCATGAGGCAATTCAGAAATTTATTAGGGNAACTGTTGCTGATGGAGCCCCAGTT
GTACCAATCTCTGCX\
Edits in Original Sequence 
(5')CTGCGACGCCGCCGTTTCACTCTTCTCCGTTTCAGACTTGAAAATTACCGACATCTGAAGAAGTATCAAAGAACAGCTAAAAATGT
CTCGGAAAGGATTGATGGAGCAGGACCTGAGtAAGTTGGATGTAACAAAGTTGCATCCACTTTCACCAGAGGTTATTTCTCGTCAGGCTA
CAATAAATATTGGTACCATTGGGCATGTGGCTCATGGGAAGTCAACAGTTGTAAAAGCTATATCTGGAGTGCAGACTGTTCGTTTTAAAA
ATGAGCTAGAAAGAAACATCACAATTAAGCTTGGATATGCTAATGCTAAGATATATAAATGTGAAGAAGACCGCTGCCCTAGACCCATGT
GCTACAAGGCATATGGAAGTGGAAAAGAAGACGGTCCCATGTGTGATGTCCCCGGTTTCGAGACCTGTAGGATGAAATTGCTGAGACATG
TATCTTTCGTTGATTGCCCCGGTCATGATATTCTCATGGCTACTATGCTTAATGGAGCTGCAATTATGGATGGAGCATTACTTCTAATTG
CTGCTAATGAGAGCTGTCCCCAACCTCAGACTTCTGAACATTTAGCTGCTGTAGAAATTATGCXGCCTNCAACACATAATAATTCTCCAA
ATAGGGTTGATCTAGTTCAGGAAAATGTTGCCATTAACCAGCATGAGGCAATTCAGAAATTTATTAGGGNAACTGTTGCTGATGGAGCCC
CAGTTGTACCAATCTCTGCX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan