ESTScan Details for Unigene SGN-U271225

Score 
493
Direction 
Forward
Predicted Peptide Sequence 
MASFDIPTIDVSPFFSSEENEEGKKKATEQMREACVNYGFFQIANHKIPLELLSRTMDMYKTFFASSDEEKLLVPNNYFKSTQNSAETYE
HFVFRLSSSVVNVCPKNPPHFKQLLEEMASHFTNLGFVLGRIISECLGLPPNFLANYRNDQARDFLLGIHYSPATEAENVGKSAHKDPGC
ITILX
Predicted Coding Sequence 
ATGGCTAGTTTTGACATTCCAACAATTGATGTTTCTCCATTTTTTAGTTCAGAGGAAAATGAAGAAGGGAAAAAGAAGGCTACTGAGCAA
ATGAGAGAAGCTTGTGTTAACTATGGTTTTTTCCAGATTGCGAATCACAAAATTCCTTTGGAGTTGTTGAGCAGAACGATGGATATGTAT
AAGACTTTCTTTGCTTCTTCAGATGAAGAAAAACTGTTGGTACCTAATAATTATTTCAAAAGCACACAGAATTCAGCTGAGACTTATGAG
CACTTTGTGTTTCGTCTTTCATCCTCTGTCGTCAATGTCTGCCCCAAAAATCCACCTCATTTCAAGCAATTATTGGAGGAGATGGCTTCG
CATTTCACAAATTTAGGATTTGTATTGGGGAGAATCATAAGTGAGTGTCTGGGCCTCCCTCCTAACTTCCTAGCAAACTACAGAAATGAT
CAGGCTAGGGATTTCTTGCTCGGCATCCACTACAGTCCAGCGACAGAAGCTGAGAACGTAGGAAAATCCGCACACAAAGATCCTGGCTGC
ATCACCATTCTCTAX\
Edits in Original Sequence 
TTAAATTCTGCTTCACTATTTTATTTGAGTGAATAATTGATACCTTGTCTATTGAGAGTGGAGAAAATTAAGGAAGACATC(5')ATGGC
TAGTTTTGACATTCCAACAATTGATGTTTCTCCATTTTTTAGTTCAGAGGAAAATGAAGAAGGGAAAAAGAAGGCTACTGAGCAAATGAG
AGAAGCTTGTGTTAACTATGGTTTTTTCCAGATTGCGAATCACAAAATTCCTTTGGAGTTGTTGAGCAGAACGATGGATATGTATAAGAC
TTTCTTTGCTTCTTCAGATGAAGAAAAACTGTTGGTACCTAATAATTATTTCAAAAGCACACAGAATTCAGCTGAGACTTATGAGCACTT
TGTGTTTCGTCTTTCATCCTCTGTCGTCAATGTCTGCCCCAAAAATCCACCTCATTTCAAGCAATTATTGGAGGAGATGGCTTCGCATTT
CACAAATTTAGGATTTGTATTGGGGAGAATCATAAGTGAGTGTCTGGGCCTCCCTCCTAACTTCCTAGCAAACTACAGAAATGATCAGGC
TAGGGATTTCTTGCTCGGCATCCACTACAGTCCAGCGACAGAAGCTGAGAACGTAGGAAAATCCGCACACAAAGATCCTGGCTGCATCAC
CATTCTCTAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan