ESTScan Details for Unigene SGN-U271333

Score 
294
Direction 
Forward
Predicted Peptide Sequence 
ILSVDXATYFHTLNSDLEMMKVVLKLEYLDEKVKQKVMKKVSVVEGVDSMSIDTKDKKLTVTGNVDPVVLVSKLKKLCHTEILSVGPAKE
PEKKKDEPKKEDDKKKAAAVAAATAAIKAYPAPVPINISISNLIRITRPPVPAYQHYYSVEEDPNSCVIC
Predicted Coding Sequence 
ATTTTAAGTGTTGATXTTGCTACTTACTTCCATACACTTAATTCAGATCTCGAGATGATGAAAGTAGTGCTGAAGTTGGAGTATCTGGAT
GAAAAAGTCAAGCAGAAGGTCATGAAAAAAGTTTCTGTTGTGGAAGGGGTAGACTCAATGTCGATAGATACAAAGGACAAGAAATTGACA
GTAACGGGAAACGTAGATCCAGTTGTATTAGTTTCAAAATTGAAGAAACTGTGTCACACTGAAATACTCTCTGTCGGACCAGCAAAAGAG
CCAGAAAAGAAGAAAGATGAGCCGAAGAAAGAGGATGACAAAAAGAAAGCGGCGGCGGTGGCAGCGGCAACAGCAGCAATAAAGGCATAT
CCAGCTCCAGTTCCTATCAATATCAGTATCAGCAACCTTATCCGCATTACCCGACCXCCTGTTCCTGCTTATCAGCACTATTACAGCGTG
GAAGAGGATCCTAACTCTTGTGTTATCTGCTAA\
Edits in Original Sequence 
(5')ATTTTAAGTGTTGATXTTGCTACTTACTTCCATACACTTAATTCAGATCTCGAGATGATGAAAGTAGTGCTGAAGTTGGAGTATCT
GGATGAAAAAGTCAAGCAGAAGGTCATGAAAAAAGTTTCTGTTGTGGAAGGGGTAGACTCAATGTCGATAGATACAAAGGACAAGAAATT
GACAGTAACGGGAAACGTAGATCCAGTTGTATTAGTTTCAAAATTGAAGAAACTGTGTCACACTGAAATACTCTCTGTCGGACCAGCAAA
AGAGCCAGAAAAGAAGAAAGATGAGCCGAAGAAAGAGGATGACAAAAAGAAAGCGGCGGCGGTGGCAGCGGCAACAGCAGCAATAAAGGC
ATATCCAGCTCCAGTTCtCTATCAATATCAGTATCAGCAACCTTATCCGCATTACCCGACCXCCTGTTCCTGCTTATCAGCACTATTACA
GCGTGGAAGAGGATCCTAACTCTTGTGTTATCTGCTAA\(3')CTTCACATTGTGTTTATTTGTGATGGGTTAGTGGAGTAGTTCAGTTC
TCACACATATCAATTCTTTTCGGAATTTTATCATACAGTTGGTATGTGTTATATCATGCAAACCTCTTTA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan