ESTScan Details for Unigene SGN-U271365

Score 
451
Direction 
Forward
Predicted Peptide Sequence 
FEXEKDERRKKRAAEASNKVAWKPNAGIKINETEVGGKFRPLSEITGVCLRCRDQIDWKRKYGKYKAITEPAKXSEVFEKKRAQAYHNLC
NGCAKEHKVCAKCSCRVGQVVGRDVSEVEAEKKALEEAIKNARERDRRSLLRAMNKGKSQSSEKNLTQDDMKVGELNTASSLEEYAEVSR
DDEEDDDEDEDEDQVI
Predicted Coding Sequence 
XTTTTTGAAGAXGAAAAAGATGAGCGGCGTAAGAAAAGGGCCGCCGAAGCATCAAACAAAGTCGCCTGGAAACCTAACGCCGGTATCAAA
ATCAATGAAACGGAAGTGGGTGGAAAATTTAGGCCTCTCTCAGAAATAACAGGAGTATGTCTTCGTTGTAGAGATCAAATTGATTGGAAG
CGCAAGTATGGAAAATACAAAGCCATTACTGAACCTGCTAAGXTGTCAGAAGTGTTCGAAAAGAAACGTGCTCAAGCTTACCACAATCTC
TGCAATGGCTGTGCAAAGGAGCATAAAGTATGTGCCAAGTGTTCATGTCGTGTTGGTCAAGTGGTTGGAAGAGATGTTTCAGAAGTAGAG
GCTGAGAAAAAAGCTCTTGAGGAGGCTATCAAGAATGCTCGAGAACGGGATAGGCGGTCACTTCTACGTGCTATGAACAAAGGGAAGTCA
CAGAGTTCAGAGAAAAACCTAACTCAAGATGACATGAAGGTTGGTGAACTGAATACAGCATCATCACTTGAGGAATATGCGGAGGTAAGC
CGTGATGATGAGGAGGATGATGATGAAGATGAAGATGAAGATCAAGTTATTTGA\
Edits in Original Sequence 
(5')XTTTTTGAAGAXGAAAAAGATGAGCGGCGTAAGAAAAGGGCCGCCGAAGCATCAgAACAAAGTCGCCTGGAAACCTAACGCCGGTA
TCAAAATCAATGAAACGGAAGTGGGTGGAAAATTTAGGCCTCTCTCAGAAATAACAGGAGTATGTCTTCGTTGTAGAGATCAAATTGATT
GGAAGCGCAAGTATGGAAAATACAAAGCCATTACTGAACCTGCTAAGXTGTCAGAAGTGTTCGAAAAGAAACGTGCgTCAAGCTTACCAC
AATCTCTGCAATGGCTGTGCAAAGGAGCATAAAGTATGTGCCAAGTGTTCATGTCGTGTTGGTCAAGTGGTTGGAAGAGATGTTTCAGAA
GTAGAGGCTGAGAAAAAAGCTCTTGAGGAGGCTATCAAGAATGCTCGAGAACGGGATAGGCGGTCACTTCTACGTGCTATGAACAAAGGG
AAGTCACAGAGTTCAGAGAAAAACCTAACTCAAGATGACATGAAGGTTGGTGAACTGAATACAGCATCATCACTTGAGGAATATGCGGAG
GTAAGCCGTGATGATGAGGAGGATGATGATGAAGATGAAGATGAAGATCAAGTTATTTGA\(3')GATGCGCAATTTGGAGAATAAATCC
CATATGGCCCTTTATAGATCTCTCTTTATGGTCCCTAGTTTGATGCACACTAGCTCATTTGTATTGTCCGCTTTGGAGAAAAGTAAATTT
ATTCGGCACAATTGATATAGGCTGTTTGGTTTACCCCCTTTCTACAGTAAAGCGACTAAGAGTGAGATCACACACTATTCCATTTCCTTT
TTCCATTTCATATTTTGTTAGCTTACGTGAACAGTTTTGAGAGTGTTAATCCTAGAGTTAAAGTAGATTCTTAAG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan