ESTScan Details for Unigene SGN-U271389

Score 
947
Direction 
Forward
Predicted Peptide Sequence 
KPKPLGAISISRYAEITXDQKMADSANSKNYGVPIYGAGWVPPSALRSAVEPSADDEKDDGDKSSPSAPGNYVVLSGGGGEGNIGIRNAL
IVAQFDYDSNVLSDEPVARLGTGGDLPYRMAVHPGGEGLIAHCQKAADGLTGIFRQXENRSLGLRSSEKVLEPLEDVGQQLALTFNNEGS
LLAVGGEDGKLTVFKWPSMENILDQANAHASVKDLDFSPDGKFLASVGSGPCRIWDVSKSTSVASLTKENDEIFGYCRFAPISDENQVLY
ITTMRDQGGSISKWSTTTWRRIKSKRVVRDPICAFNISPNGKLLAIGTIEGDVLVVSSNNLQVQNVVKKAHLGLVTTLKFSEDSRALLSA
SLDSRVRVTIIKEEKKSGLSLWIVILVLLIAIADIMQQATGFFHWS
Predicted Coding Sequence 
XXCAAACCAAAGCCCCTTGGTGCCATCTCAATTTCTCGATACGCTGAGATCACAGXTGACCAAAAGATGGCTGATTCCGCCAATTCGAAG
AACTATGGAGTCCCAATTTACGGTGCCGGTTGGGTTCCACCGAGCGCTCTCAGATCTGCCGTCGAACCGTCGGCCGATGATGAAAAGGAC
GACGGAGACAAATCATCGCCCTCAGCACCGGGAAACTATGTTGTCCTTTCCGGAGGCGGTGGGGAAGGGAATATCGGTATTCGTAACGCT
CTCATTGTTGCTCAATTCGATTACGATTCTAATGTGCTCTCTGATGAACCTGTGGCTAGGTTAGGAACTGGAGGTGATCTGCCTTATAGG
ATGGCAGTACATCCAGGTGGAGAAGGTCTTATTGCTCATTGCCAAAAAGCTGCAGATGGTTTGACTGGGATTTTCAGACAAXCTGAAAAT
CGTTCATTGGGTCTGCGATCATCTGAGAAAGTACTTGAGCCATTGGAAGATGTTGGACAACAATTAGCGCTAACTTTTAACAATGAAGGT
TCTTTACTTGCTGTCGGTGGTGAGGATGGCAAGTTGACGGTTTTTAAGTGGCCTAGCATGGAAAATATTCTTGATCAGGCTAATGCTCAT
GCTTCTGTGAAGGATCTAGACTTCAGCCCTGATGGAAAATTTCTTGCATCTGTTGGAAGCGGCCCTTGCCGGATTTGGGATGTGTCAAAA
TCAACCTCTGTAGCTTCTTTGACGAAGGAAAATGATGAGATTTTTGGCTATTGTAGATTCGCACCAATTAGCGATGAGAATCAGGTTCTA
TACATCACCACTATGCGAGATCAAGGTGGAAGTATTTCGAAGTGGAGTACTACTACGTGGAGGAGGATAAAATCAAAGCGCGTTGTTCGT
GATCCTATTTGTGCTTTCAATATTTCACCCAATGGAAAGCTTCTGGCAATAGGAACAATTGAGGGAGATGTTCTGGTAGTGTCTTCCAAC
AATCTTCAAGTGCAAAATGTTGTAAAAAAGGCTCATCTTGGTCTTGTAACAACATTGAAGTTCTCAGAAGATTCGAGGGCTTTGCTTTCT
GCCTCCTTGGATTCCAGAGTGAGAGTGACAATTATAAAGGAAGAGAAGAAAAGTGGTCTGAGCTTGTGGATCGTTATACTCGTTCTTTTG
ATTGCAATTGCTGATATTATGCAGCAAGCAACGGGATTCTTCCATTGGAGCTAA\
Edits in Original Sequence 
(5')XXCAAACCAAAGCCCCTTGGTGCgCATCTCAATTTCTCGATACGCTGAGATCACAGXTGACCAAAAGATGGCTGATTCCGCCAATT
CGAAGAACTATGGAGTCCCAATTTACGGTGCCGGTTGGGTTCCACCGAGCGCTCTCAGATCTGCCGTCGAACCGTCGGCCGATGATGAAA
AGGACGACGGAGACAAATCATCGCCCTCAGCACCGGGAAACTATGTTGTCCTTTCCGGAGGCGGTGGGGAAGGGAATATCGGTATTCGTA
ACGCTCTCATTGTTGCTCAATTCGATTACGATTCTAATGTGCTCTCTGATGAACCTGTGGCTAGGTTAGGAACTGGAGGTGATCTGCCTT
ATAGGATGGCAGTACATCCAGGTGGAGAAGGTCTTATaTGCTCATTGCCAAAAAGCTGCAGATGGTTTGACTGGGATTTTCAGACAAXCT
GAAAATCGTTCATTGGGTCTGCGATCATCTGAGAAAGTACTTGAGCCATTGGAAGATGTTGGACAACAATTAGCGCTAACTTTTAACAAT
GAAGGTTCTTTACTTGCTGTCGGTGGTGAGGATGGCAAGTTGACGGTTTTTAAGTGGCCTAGCATGGAAAATATTCTTGATCAGGCTAAT
GCTCATGCTTCTGTGAAGGATCTAGACTTCAGCCCTGATGGAAAATTTCTTGCATCTGTTGGAAGCGGCCCTTGCCGGATTTGGGATGTG
TCAAAATCAACCTCTGTAGCTTCTTTGACGAAGGAAAATGATGAGATTTTTGGCTATTGTAGATTCGCACCAATTAGCGATGAGAATCAG
GTTCTATACATCACCACTATGCGAGATCAAGGTGGAAGTATTTCGAAGTGGAGTACTACTACGTGGAGGAGGATAAAATCAAAGCGCGTT
GTTCGTGATCCTATTTGTGCTTTCAATATTTCACCCAATGGAAAGCTTCTGGCAATAGGAACAATTGAGGGAGATGTTCTGGTAGTGTCT
TCCAACAATCTTCAAGTGCAAAATGTTGTAAAAAAGGCTCATCTTGGTCTTGTAACAACATTGAAGTTCTCAGAAGATTCGAGGGCTTTG
CTTTCTGCCTCCTTGGATTCCAGAGTGAGAGTGACAATTATAAAGGAAGAGAAGAAAAGTGGTCTGAGCTTGTGGATCGTTATACTCGTT
CTTTTGATTGCAATTGCTGtATATTATGCAGCAAGCAACGGGATTCTTCCATTGGAGCTAA\(3')ACTCTATATTAAAATGAGGAGCTT
TACCCCCCAAAGTATTCTTATATGTGAAACGGTATCTGAAACATTTTTGAAGGCTGTCTCTGGAACAGTATGCTTGGATTCGAGATTAAT
TAAAAAACATCTGGTGTTTTTAACGTGCTTAAACTGTTAGACACAGAGAGTTTATATACCTATTTGTCCTCC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan