ESTScan Details for Unigene SGN-U271524

Score 
498
Direction 
Forward
Predicted Peptide Sequence 
MSSDLIANTHGNLDEQISQLMQCKPLSEPEVRALCEKAKEILMEESNVQPVKSPVTICGDIHGQFHDLAELFRIGGQCPDTNYLFMGDYV
DRGYYSVETVTLLVALKVRYPQRLTILEEITKADRSHKXYGFYDECLRKYGNANVWKTFTDLFDYFPLTALVESEIFCLHGGLSPSIETL
DNVRSFDRVQEVPHEGAMCDLLWSDPDDRCGWGMSPRGAGYTFGQDISEQFHHTNNLKLIARAHQLVMEGYNWSHEQKVVTIFSAPNYCY
RCGNMASILEVDDCRGHTFIQFDPAPRRGEPDVTRRTPDYFXINVMESNIYGLPSAVFCDNFHHCRDVSAFMAKLIGCSREESEDKEA
Predicted Coding Sequence 
ATGAGTTCAGATCTGATAGCTAACACACATGGTAACCTGGATGAGCAGATTTCTCAGCTTATGCAGTGCAAGCCTCTATCTGAGCCTGAG
GTTAGAGCATTATGTGAGAAGGCTAAGGAGATACTAATGGAAGAAAGTAATGTTCAGCCAGTAAAAAGCCCTGTGACTATATGTGGTGAT
ATTCATGGGCAGTTCCATGATCTTGCTGAACTTTTTAGGATTGGTGGACAGTGTCCAGATACAAATTATCTGTTTATGGGTGATTACGTT
GACCGTGGATATTATTCGGTTGAAACAGTTACTCTATTGGTAGCTCTGAAAGTGCGTTATCCTCAACGACTAACAATTCTTGAGGAAATC
ACGAAAGCCGACAGATCACACAAGXTCTATGGGTTCTACGATGAATGCTTGCGGAAGTATGGCAATGCTAATGTTTGGAAAACATTTACT
GATCTATTTGATTATTTTCCTTTGACGGCATTGGTTGAATCCGAAATTTTTTGTTTGCATGGAGGACTGTCTCCATCTATTGAAACCCTT
GATAATGTACGAAGTTTCGACCGTGTCCAAGAAGTTCCTCATGAAGGGGCCATGTGTGATCTTTTGTGGTCAGACCCAGATGATCGTTGT
GGTTGGGGTATGTCACCCCGGGGTGCTGGATACACTTTTGGGCAGGACATATCTGAGCAATTTCACCATACCAATAATCTAAAGCTGATT
GCTCGAGCTCATCAGCTGGTTATGGAGGGATATAACTGGAGCCATGAACAAAAAGTTGTCACTATTTTTAGTGCACCAAATTATTGTTAT
CGATGTGGAAACATGGCCTCTATTTTGGAAGTTGATGACTGCAGAGGGCACACATTTATCCAGTTTGATCCAGCTCCAAGAAGGGGAGAA
CCGGATGTAACACGAAGAACCCCTGATTACTTCTTXATAAATGTGATGGAGAGCAATATCTATGGTCTGCCAAGTGCTGTTTTTTGCGAT
AACTTCCATCATTGTCGAGATGTGAGTGCATTTATGGCAAAGCTAATAGGCTGCTCCCGGGAGGAATCCGAGGATAAAGAGGCTTGA\
Edits in Original Sequence 
CTTGCATTTTCTCTTCTTCTTCTTCTTCTTCTTGCCCAGAAGAACAAAAATACATAAAAGCAAAGGGCTTTTGTGGGTTGGTGGCAAAAA
AATTTCAGAAATTTATTCAAGATTATATATTGGGAAAAAGGAAAATTGATTATTGAAGTTGAAATTTTTTAGTTTGAAGATTAGTTGTAC
GAA
(5')ATGAGTTCAGATCTGATAGCTAACACACATGGTAACCTGGATGAGCAGATTTCTCAGCTTATGCAGTGCAAGCCTCTATCTGA
GCCTGAGGTTAGAGCATTATGTGAGAAGGCTAAGGAGATACTAATGGAAGAAAGTAATGTTCAGCCAGTAAAAAGCCCTGTGACTATATG
TGGTGATATTCATGGGCAGTTCCATGATCTTGCTGAACTTTTTAGGATTGGTGGACAGTGTCCAGATACAAATTATCTGTTTATGGGTGA
TTACGTTGACCGTGGATATTATTCGGTTGAAACAGTTACTCTATTGGTAGCTCTGAAAGTGCGTTATCCTCAACGACTAACAATTCTTaG
AGGAAATCACGAAAGCCGACAGATCACACAAGXTCTATGGGTTCTACGATGAATGCTTGCGGAAGTATGGCAATGCTAATGTTTGGAAAA
CATTTACTGATCTATTTGATTATTTTCCTTTGACGGCATTGGTTGAATCCGAAATTTTTTGTTTGCATGGAGGACTGTCTCCATCTATTG
AAACCCTTGATAATGTACGAAGTTTCGACCGTGTCCAAGAAGTTCCTCATGAAGGGGCCATGTGTGATCTTTTGTGGTCAGACCCAGATG
ATCGTTGTGGTTGGGGTATGTCACCCCGGGGTGCTGGATACACTTTTGGGCAGGACATATCTGAGCAATTTCACCATACCAATAATCTAA
AGCTGATTGCTCGAGCTCATCAGCTGGTTATGGAGGGATATAACTGGAGCCATGAACAAAAAGTTGTCACTATTTTTAGTGCACCAAATT
ATTGTTATCGATGTGGAAACATGGCCTCTATTTTGGAAGTTGATGACTGCAGAGGGCACACATTTATCCAGTTTGATCCAGCTCCAAGAA
GGGGAGAACCGGATGTAACACGAAGAACCCCTGATTACTTCTTXATAAATGTGATGGAGAGCAATATCTATGGTCTGCCAAGTGCTGTTT
TTTGCGATAACTTCCATCtATTGTCGAGATGTGAGTGCATTTATGGCAAAGCTAATAGGCTGCTCCCGGGAGGtAATCCGAGGATAAAGA
GGCTTGA\(3')CCAGGTCCCCCCCCTTGGTTAAAGTCATATTCTAACCTATGTTAGGAATATTAGAGTGGAGAAGTGCAGCCAGCAATG
CTGTTATGTATGATTTCATGAAGACTTGTTTTCTGTTGTTCCTTTCCAAGCTCTGATTTTCAGTCTTAGTGTGATAATTTTGTCATATGT
TGGTTGCAAGGAAGTCTGTTGTGTAAAGTTAAGAATCATCTACTTTACATTGTAACTTTTACCTTGTTAATGCAGCTCATCCTTTCTTTC
TGAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan