ESTScan Details for Unigene SGN-U271590

Score 
949
Direction 
Forward
Predicted Peptide Sequence 
MAPSTLTALANEKTLQTSFIRDEEERPKVAYNKFSDEIPVISLQGIDDINGSRRSEICEKIVNACEDWGVFQVIDHGVDAELISEMTKLA
KEFFELPPDEKLRFDMSGGKKGGFIVSSHLQGEVVQDWREIVTYFSYPIRARDYSRWPDKPQGWIAVTEKYSEKLMDLACKLLEVLSEAM
GLEKEALTKACVDMDQKVVVNFYPKCPEPDLTLGLNDXTDPGTITLLLQDQVGGLQATKDNGKTWITVQPVEGAFVVNLGDHGHYLSNGR
FKNADHQAVVNSNSSRLSIATFQNPAPDAKVYPLKIREGEKAIMDEPITFAEMYRRKMSKDLELARLKKLAKEQTEEAKLESKPIEEILA
KFYNFNTYNIGSWNKRLRV
Predicted Coding Sequence 
ATGGCACCTTCAACACTAACAGCTCTAGCTAATGAAAAGACCCTTCAAACAAGTTTTATTAGGGATGAAGAAGAACGTCCAAAAGTGGCT
TACAATAAATTTAGTGACGAAATTCCAGTAATATCGTTGCAAGGTATTGATGATATTAATGGAAGTCGAAGAAGTGAAATATGTGAGAAA
ATTGTAAATGCTTGTGAAGATTGGGGAGTTTTTCAGGTAATTGATCATGGGGTCGATGCTGAATTAATATCAGAAATGACAAAATTGGCT
AAGGAATTTTTCGAATTGCCTCCTGACGAAAAGCTTCGGTTTGACATGTCTGGTGGCAAGAAAGGTGGCTTTATTGTCTCAAGCCATTTA
CAGGGTGAAGTGGTTCAAGACTGGCGTGAAATAGTGACCTACTTTTCATACCCAATTCGAGCTAGAGACTACTCTAGATGGCCAGACAAA
CCACAAGGCTGGATAGCTGTAACTGAGAAATACAGTGAAAAATTAATGGACTTGGCTTGCAAATTATTAGAAGTATTATCAGAGGCAATG
GGCTTAGAGAAAGAGGCTTTAACCAAGGCATGTGTGGATATGGACCAAAAAGTAGTTGTCAATTTTTACCCAAAGTGTCCAGAGCCTGAC
CTTACCCTTGGGCTGAACGACATXACTGATCCAGGAACCATCACCCTCTTGTTACAAGACCAAGTTGGTGGGCTTCAAGCCACTAAAGAT
AATGGCAAAACTTGGATCACTGTTCAGCCCGTTGAAGGCGCTTTTGTTGTTAATCTTGGTGATCATGGTCATTATTTGAGCAATGGGAGG
TTCAAGAATGCTGATCATCAAGCAGTTGTGAATTCGAATAGCAGCAGATTATCGATAGCCACTTTTCAGAATCCAGCACCGGATGCAAAA
GTGTATCCGTTAAAAATTAGGGAAGGAGAGAAGGCAATAATGGATGAGCCGATTACATTTGCAGAAATGTACAGGAGGAAAATGAGTAAG
GATCTTGAGCTTGCTAGGCTCAAGAAACTGGCCAAGGAACAGACTGAAGAGGCCAAGTTGGAGTCCAAGCCCATTGAGGAAATTCTTGCT
AAGTTTTACAATTTTAACACTTACAATATTGGATCTTGGAACAAGAGGCTACGCGTGTAA\
Edits in Original Sequence 
CTCTTTTGAACAAACAAACAAACAAAAAAATAAAAAAA(5')ATGGCACCTTCAACACTAACAGCTCTAGCTAATGAAAAGACCCTTCAA
ACAAGTTTTATTAGGGATGAAGAAGAACGTCCAAAAGTGGCTTACAATAAATTTAGTGACGAAATTCCAGTAATATCGTTGCAAGGTATT
GATGATATTAATGGAAGTCGAAGAAGTGAAATATGTGAGAAAATTGTAAATGCTTGTGAAGATTGGGGAGTTTTTCAGGTAATTGATCAT
GGGGTCGATGCTGAATTAATATCAGAAATGACAAAATTGGCTAAGGAATTTTTCGAATTGCCTCCTGACGAAAAGCTTCGGTTTGACATG
TCTGGTGGCAAGAAAGGTGGCTTTATTGTCTCAAGCCATTTACAGGGTGAAGTGGTTCAAGACTGGCGTGAAATAGTGACCTACTTTTCA
TACCCAATTCGAGCTAGAGACTACTCTAGATGGCCAGACAAACCACAAGGCTGGATAGCTGTAACTGAGAAATACAGTGAAAAATTAATG
GACTTGGCTTGCAAATTATTAGAAGTATTATCAGAGGCAATGGGCTTAGAGAAAGAGGCTTTAACCAAGGCATGTGTGGATATGGACCAA
AAAGTAGTTGTCAATTTTTACCCAAAGTGTCCAGAGCCTGACCTTACCCTTGGGCTGAACGACATXACTGATCCAGGAACCATCACCCTC
TTGTTACAAGACCAAGTTGGTGGGCTTCAAGCCACTAAAGATAATGGCAAAACTTGGATCACTGTTCAGCCCGTTGAAGGCGCTTTTGTT
GTTAATCTTGGTGATCATGGTCATTATTTGAGCAATGGGAGGTTCAAGAATGCTGATCATCAAGCAGTTGTGAATTCGAATAGCAGCAGA
TTATCGATAGCCACTTTTCAGAATCCAGCACCGGATGCAAAAGTGTATCCGTTAAAAATTAGGGAAGGAGAGAAGGCAATAATGGATGAG
CCGATTACATTTGCAGAAATGTACAGGAGGAAAATGAGTAAGGATCTTGAGCTTGCTAGGCTCAAGAAACTGGCCAAGGAACAGACTGAA
GAGGCCAAGTTGGAGTCCAAGCCCATTGAGGAAATTCTTGCtTAAGTTTTACAATTTTAACACTTACAATATTGGATCTTGGAACAAGAG
GCTACGCGTGTAA\(3')TTTCTTTTATCAGTATTGTCTTGAATAACAATAAATCATGTTCTTGTAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan