ESTScan Details for Unigene SGN-U271603

Score 
365
Direction 
Reverse
Predicted Peptide Sequence 
MENLFNRSQQARPRYSSRGKPVQSVHQKSAGIKPATKVVQIPVHSVSSDPDRTSPTQKSDDVAQAPDRRSGSALRIQKVFRGYMVRKNVK
RIMSIRKEVDEIERKLLCGETAELIRRDERERLRVNETLMSLLFKLDSIRGVDSGVRECRKGVIKKAISLQEKVDSIVPPAAN
Predicted Coding Sequence 
ATGGAAAATCTTTTCAATAGGTCTCAGCAAGCTCGCCCTCGCTATTCCTCGAGAGGAAAACCAGTACAATCGGTCCATCAGAAATCTGCC
GGAATCAAGCCGGCGACGAAGGTTGTTCAGATTCCGGTCCACTCCGTCAGTTCCGATCCAGATCGGACCTCCCCGACACAGAAATCTGAT
GATGTGGCGCAGGCGCCTGATAGAAGATCCGGTTCAGCGTTAAGGATCCAGAAGGTATTTCGTGGTTATATGGTGAGGAAAAACGTGAAG
AGAATTATGTCAATACGAAAAGAGGTGGATGAAATTGAGCGGAAGCTTTTATGCGGAGAAACGGCGGAGTTGATTCGGAGAGACGAAAGG
GAAAGGTTGCGGGTGAATGAAACGCTGATGTCTCTGCTTTTCAAGTTGGACTCCATTCGTGGAGTTGATTCTGGTGTTAGAGAGTGCAGA
AAGGGTGTGATTAAGAAGGCCATCTCCTTGCAAGAAAAAGTTGACTCCATTGTTCCCCCXGCAGCTAATTAA\
Edits in Original Sequence 
TTTTTTTTTTAGCAGAAAATCTAACCGCTTCTCTCATTGAATTTTACAATACAAATTCGTTAGCTATCAAATATTCAAATAAAATATCTC
AACTAACCGATCAAAGTTATCA
(5')ATGGAAAATCTTTTCAATAGGTCTCAGCAAGCTCGCCCTCGCTATTCCTCGAGAGGAAAACCAG
TACAATCGGTCCATCAGAAATCTGCCGGAATCAAGCCGGCGACGAAGGTTGTTCAGATTCCGGTCCACTCCGTCAGTTCCGATCCAGATC
GGACCTCCCCGACACAGAAATCTGATGATGTGGCGCAGGCGCCTGATAGAAGATCCGGTTCAGCGTTAAGGATCCAGAAGGTATTTCGTG
GTTATATGGTGAGGAAAAACGTGAAGAGAATTATGTCAATACGAAAAGAGGTGGATGAAATTGAGCGGAAGCTTTTATGCGGAGAAACGG
CGGAGTTGATTCGGAGAGACGAAAGGGAAAGGTTGCGGGTGAATGAAACGCTGATGTCTCTGCTTTTCAAGTTGGACTCCATTCGTGGAG
TTGATTCTGGTGTTAGAGAGTGCAGAAAGGGTGTGATTAAGAAGGCCATCTCCTTGCAAGAAAAAGTTGACTCCATTGTTCCCCCXGCAG
CTAATTAA\(3')TTGCGAATAGAGTGTGCGTAGACCTTACTCTCATCTCGTAAAGCAGGGGTGTGGGTGCAGAAAATCAAGCAAACATC
GAATTGTACTAAAAATGAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan