ESTScan Details for Unigene SGN-U271616

Score 
653
Direction 
Forward
Predicted Peptide Sequence 
KVVGVRPAGVDVFGSARRQEEKFNFGTNYXQYMLVSDILSFLIISNSTRFAIDMAGSGEESKKLQLYSYWRSSCAFRVRIALNLKGLDYE
YKAVNLLKGEQRDPEYLKLNPLGYVPTLVDGDAVIADSFAXLNVSGREVSPAALLPQDCQKRAINYQAANIVAANIQPLQNLAVLKYIHE
KVGPNETTPWVQSHITKGFEALEKLLKDYAGKYATGDEVYMADLFLAPQIHAAIKRFEVDMNQFPTLLRVFEAYQELPAFQDAMPEKQPD
ATMLRQESEAIHLLSQTIGITAGLXILAELLTVAAHSISEGIAFCKLLYDE
Predicted Coding Sequence 
XXCAAAGTAGTCGGAGTGAGGCCGGCAGGCGTAGACGTATTCGGGTCGGCCCGCCGACAAGAGGAAAAATTCAATTTTGGTACCAACTAT
XATCAGTATATGTTAGTATCAGATATTCTGTCCTTCTTGATCATTTCTAACAGTACAAGATTTGCCATTGATATGGCAGGGAGCGGGGAG
GAATCAAAGAAGTTGCAGCTCTACTCATATTGGAGGAGTTCATGTGCATTTCGTGTTCGAATAGCTCTTAATTTGAAAGGATTGGATTAT
GAGTATAAAGCTGTTAACTTGCTTAAAGGAGAACAAAGGGACCCTGAATACTTGAAGCTGAATCCCCTTGGATATGTGCCAACATTGGTG
GATGGAGATGCAGTAATAGCTGACTCTTTTGCTXATCTTAATGTATCTGGAAGAGAAGTATCCCCAGCAGCATTGTTGCCTCAGGATTGT
CAGAAAAGAGCAATCAACTATCAGGCTGCAAACATTGTTGCGGCAAACATTCAGCCTCTACAGAATCTTGCTGTACTTAAGTACATCCAC
GAAAAAGTTGGCCCTAATGAGACAACCCCTTGGGTTCAAAGTCATATAACAAAAGGCTTTGAAGCACTTGAAAAGCTACTTAAAGATTAT
GCTGGAAAGTATGCAACAGGAGATGAAGTTTACATGGCCGACTTGTTTCTGGCACCTCAGATCCATGCGGCAATCAAGCGTTTTGAAGTT
GACATGAATCAATTCCCTACTCTGTTGAGGGTATTTGAGGCTTACCAAGAGCTGCCTGCTTTCCAGGATGCTATGCCAGAAAAACAGCCT
GATGCCACXATGCTGAGGCAAGAATCTGAGGCCATCCATCTTCTTTCTCAAACCATTGGCATAACTGCTGGACTTGAXATTTTGGCAGAA
TTGTTAACTGTTGCTGCACATTCTATTTCTGAAGGCATTGCCTTTTGTAAACTTCTTTACGATGAATAA\
Edits in Original Sequence 
(5')XXCAAAGTAGTCGGAGTGAGGCCGGCAGGCGTAGACGTATTCGGGTCgGGCCCGCCGACAAGAGGAAAAATTCAATTTTGGTACCA
ACTATXATCAGTATATGTTAGTATCAGATATTCTGTCCTTCTTGATCATTTCTAACAGTACgAAGATTTGCCATTGATATGGCAGGGAGC
GGGGAGGAATCAAAGAAGTTGCAGCTCTACTCATATTGGAGGAGTTCATGTGCATTTCGTGTTCGAATAGCTCTTAATTTGAAAGGATTG
GATTATGAGTATAAAGCTGTTAACTTGCTTAAAGGAGAACAAAGGGACCCTGAATACTTGAAGCTGAATCCCCTTGGATATGTGCCAACA
TTGGTGGATGGAGATGCAGTAATAGCTGACTCTTTTGCTXATCTTAATGTATCTGGAAGAGAAGTATCCCCAGCgAGCATTGTTGCCTCA
GGATTGTCAGAAAAGAGCAATCAACTATCAGGCTGCAAACATTGTTGCGGCAAACATTCAGCCTCTACAGAATCTTGCTGTACTTAAGTA
CATCCACGAAAAAGTTGGCCCTAATGAGACAACCCCTTGGGTTCAAAGTCATATAACAAAAGGCTTTGAAGCACTTGAAAAGCTACTTAA
AGATTATGCTGGAAAGTATGCAACAGGAGATGAAGTTTACATGGCCGACTTGTTTCTGGCACCTCAGATCCATGCGGCAATCAAGCGTTT
TGAAGTTGACATGAATCAATTCCCTACTCTGTTGAGGGTATTTGAGGCTTACCAAGAGCTGCCTGCTTTCCAGGATGCTATGCCAGAAAA
ACAGCCTGATGCCACXATGCTGAGGCAAGAATCTGAGGCCATCCATCTTCTTTCTCAAACCATTGGCATAACTGCTGGACTTGAXATTTT
GGCAGAATTGTTAACTGtTTGCTGCACATTCTATTTCTGAAGGCATTGCCTTTTGTAAACTTCTTTACGATGAATAA\(3')ATGTAGAG
CTGTGTAACACTAGCAAACTTCTTTACGATGAATACATGTAGAGCTGTGTAACACTTGCAAACTTCTTTACAATGAATAATGTAGAGCCG
TGTAACGCTTCAGTTATGGCGCAGTCATGAGCTACTGAAGTCAGATGGTGTTGTACCTATGTTAAGGAGCCGAGGATGAACATTCCTTGG
TCTCTGTTGTGATTTGTGAGATATTATAAAGTTGTCTGCATGTTGAAAAGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan