ESTScan Details for Unigene SGN-U271622

Score 
589
Direction 
Forward
Predicted Peptide Sequence 
SLRSSSEVSERRITCNERLQNPSSLFNFLFSVSNAKQLPEKFLFSHFIQFFFFPAAASTLSNPAFRIEPCRDPSRRYGSTQGAISLETSE
EMAVPRVAAESPGEKSKDTVEELLYNKDDVSKLMKMERRPDTEGLGHQERWFPYLDKVKAGSMYLSSSEILEAVTPYIMDSRKERFRHAV
KNRTYSVCLVVEGLSDFGNVSATFRSADALGIQSVHVVACDSSKRYRENRHVSMGAEKWLDIELWDSVHECFKVLKSRGYRIATTHLGMD
TVSVYDMDWSCPTAIVVGNELRGISDEALGSSDLHCSIPMKGMVDSFNVSVAAGLLMHHAVCDRTSRLGCHGDLTSEESRILLAEFSLRH
NDNAIRIAQEYAERKIAELKSKLXXVVKLVLEGRCAYLHKAPGPCIWLYAQTFQQLSS
Predicted Coding Sequence 
TCTCTGAGGAGCAGTAGTGAGGTAAGTGAGAGAAGAATCACATGCAATGAGCGCCTGCAAAACCCTAGTTCGCTCTTCAATTTCCTTTTT
TCAGTTTCAAACGCGAAGCAGCTACCGGAGAAGTTTTTATTTTCACATTTCATCCAATTTTTCTTCTTTCCGGCCGCTGCCTCTACTCTC
TCTAATCCAGCATTCAGAATCGAACCGTGTAGAGATCCTTCAAGACGATATGGCAGCACTCAAGGAGCAATTTCACTGGAAACGTCAGAA
GAAATGGCAGTTCCGCGTGTTGCCGCTGAAAGTCCGGGGGAAAAATCCAAAGACACAGTAGAGGAGTTACTGTACAACAAAGATGATGTC
TCAAAGCTGATGAAAATGGAACGCAGGCCTGATACTGAAGGCCTGGGTCATCAGGAGCGTTGGTTTCCATATTTGGATAAAGTTAAGGCG
GGAAGTATGTATTTGAGTAGTTCGGAGATATTGGAAGCAGTGACCCCGTATATAATGGATTCGAGGAAAGAGAGGTTTCGCCATGCTGTA
AAGAATCGGACATATTCAGTATGTCTGGTGGTTGAAGGTTTGAGTGATTTTGGCAATGTGTCAGCTACATTTCGCTCAGCTGATGCACTG
GGCATTCAATCAGTCCATGTTGTAGCTTGTGATAGTTCAAAAAGGTACAGGGAGAATCGACATGTTAGCATGGGAGCTGAGAAATGGTTG
GATATCGAACTATGGGATTCTGTTCATGAGTGCTTCAAAGTTTTGAAATCACGTGGTTATCGCATTGCAACAACACATCTTGGAATGGAC
ACGGTTTCTGTGTATGATATGGACTGGTCATGCCCAACTGCAATTGTTGTGGGAAATGAACTTAGGGGAATAAGTGACGAGGCTCTTGGA
TCATCAGACTTGCACTGCAGTATTCCAATGAAAGGCATGGTAGACTCATTCAATGTTTCTGTTGCTGCTGGCCTTCTTATGCACCATGCC
GTCTGTGACAGAACTTCTCGCTTGGGATGCCATGGGGATCTAACTAGTGAGGAAAGTCGAATCTTGCTAGCAGAGTTTTCTTTGCGCCAC
AACGATAATGCAATTAGAATTGCTCAAGAATATGCAGAAAGAAAGATAGCTGAACTTAAATCAAAGCTTTGATAAGTGGTCAAACTAGTT
TTAGAAGGAAGATGTGCCTATTTGCACAAAGCGCCAGGTCCATGTATATGGCTATATGCCCAGACATTTCAACAACTGAGCAGCTGA\
Edits in Original Sequence 
(5')TCTCTGAGGAGCAGTAGTGAGGTAAGTGAGAGAAGAATCACATGCAATGAGCGCCTGCAAAACCCTAGTTCGCTCTTCAATTTCCT
TTTTTCAGTTTCAAACGCGAAGCAGCTACCGGAGAAGTTTTTATTTTCACATTTCATCCAATTTTTCTTCTTTCCGGCCGCTGCCTCTAC
TCTCTCtTAATCCAGCATTCAGAATCGAACCGTGTAGAGATCCTTCAAGACGATATGGCAGCACTCAAGGAGCAATTTCACTGGAAACGT
CAGAAGAAATGGCAGTTCCGCGTGTTGCCGCTGAAAGTCCGGGGGAAAAATCCAAAGACACAGTAGAGGAGTTACTGTACAACAAAGATG
ATGTCTCAAAGCTGATGAAAATGGAACGCAGGCCTGATACTGAAGGCCTGGGTCATCAGGAGCGTTGGTTTCCATATTTGGATAAAGTTA
AGGCGGGAAGTATGTATTTGAGTAGTTCGGAGATATTGGAAGCAGTGACCCCGTATATAATGGATTCGAGGAAAGAGAGGTTTCGCCATG
CTGTAAAGAATCGGACATATTCAGTATGTCTGGTGGTTGAAGGTTTGAGTGATTTTGGCAATGTGTCAGCTACATTTCGCTCAGCTGATG
CACTGGGCATTCAATCAGTCCATGTTGTAGCTTGTGATAGTTCAAAAAGGTACAGGGAGAATCGACATGTTAGCATGGGAGCTGAGAAAT
GGTTGGATATCGAACTATGGGATTCTGTTCATGAGTGCTTCAAAGTTTTGAAATCACGTGGTTATCGCATTGCAACAACACATCTTGGAA
TGGACACGGTTTCTGTGTATGATATGGACTGGTCATGCCCAACTGCAATTGTTGTGGGAAATGAACTTAGGGGAATAAGTGACGAGGCTC
TTGGATCATCAGACTTGCACTGCAGTATTCCAATGAAAGGCATGGTAGACTCATTCAATGTTTCTGTTGCTGCTGGCCTTCTTATGCACC
ATGCCGTCTGTGACAGAACTTCTCGCTTGGGATGCCATGGGGATCTAACTAGTGAGGAAAGTCGAATCTTGCTAGCAGAGTTTTCTTTGC
GCCACAACGATAATGCAATTAGAATTGCTCAAGAATATGCAGAAAGAAAGATAGCTGAACTTAAATCAAAGCTTTGAgTAAGTGGTCAAA
CTAGTTTTAGAAGGAAGATGTGCCTATTTGCACAAAGCGCCAGGTCCATGTATATGGCTATATGCCCAGACATTTCAACAACTGAGCAGC
TGA\(3')GCGTTTGCGTTTTGTTCTGGTGCAGCTTATGTATAGTAAAATTTTACTCCTGTTTTTTTTTTTTTACATTGAACAGCCATAT
TTAAGTATCAACGGTTTATTTTATTTGTTAATTTCATAGACAATAACTCACAAAAATGTTGAGGATTCTGCTGGAAGTTTACCTGATTTA
GTTGTCTTTCCTACTCTTTTAGATTTGCGCTCTCATGTTTAGGAGGGGTTAATGTATTTGAACTATATCACCATTTTTGAAAGACTTAAT
AACATATTTGTCTAAAAAAAAAAAAAAAAAACTCGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan