ESTScan Details for Unigene SGN-U271666

Score 
1116
Direction 
Forward
Predicted Peptide Sequence 
FPIVIPSTVKPQVKLPAEQFDDDDEALDDDLDESSDSEDESEYDQLPPFKRLTKAQLAKLSKEQKKAYNDELEYREKLFMKKQLKEERKR
RKMMKKMQAAAESLPPTDPRENVDEETGGASSVPVPMPDLALPASFDSDNPTHRYRYLDSSNQWLVRPVLEPNGWDHDVGYEGINVERLF
VVKDKIPISLSSQVSKDKKDTNLQMEIASSVKHGHGKATSLGFDMQSVGKDLAYTLRSETRFCNYRKNKATAGLSVTLLGDVMTGGVKIE
DRLTFNRRGSLVVSGGAMFGRGDAAYGGSLEAMLRDKDHPLGRFLSTLGLSVMDWHGDLAIGCNSQTQIPIGRYTNLIGRVNINNKGSGQ
VSIRLNSSVTASDCFDKLNSTCQKADXATLNQHNMDDDETKVSSAPYNHLVTYNFYXWPLADGITEHAIYFLXEAKEGLGLSGFAGKSGF
PESX
Predicted Coding Sequence 
XXCTTTCCTATTGTCATCCCTTCTACAGTCAAGCCACAGGTTAAACTACCAGCAGAGCAATTTGATGATGATGATGAGGCTTTAGATGAT
GATCTGGATGAGTCTTCAGATTCGGAAGATGAATCAGAATATGATCAACTGCCACCTTTCAAGCGCTTGACCAAAGCACAGCTGGCGAAG
TTGTCCAAAGAGCAGAAGAAGGCCTACAATGATGAGTTAGAATACAGGGAAAAGCTCTTTATGAAAAAGCAGTTGAAGGAAGAGAGGAAG
AGGCGGAAGATGATGAAGAAAATGCAAGCTGCGGCTGAAAGTTTACCACCAACTGATCCCCGCGAAAATGTAGATGAAGAGACTGGTGGT
GCATCATCAGTGCCAGTACCCATGCCAGACTTGGCGTTACCTGCTTCATTTGATTCTGATAATCCAACTCATAGATATCGATATCTGGAT
TCTTCAAATCAGTGGCTTGTGAGGCCTGTCCTAGAACCCAACGGTTGGGACCATGATGTTGGTTATGAGGGCATCAACGTAGAAAGATTG
TTTGTTGTCAAAGACAAGATCCCTATATCTTTGTCCAGTCAGGTTTCAAAGGACAAAAAGGACACCAATCTTCAAATGGAAATTGCAAGT
TCAGTAAAGCATGGGCATGGAAAAGCAACTTCTTTAGGTTTTGATATGCAGTCAGTTGGTAAAGACCTAGCTTATACTCTTCGCAGTGAG
ACCAGATTCTGCAATTATAGGAAGAATAAGGCGACAGCTGGTCTTTCAGTAACTCTCTTAGGTGACGTCATGACAGGTGGTGTGAAAATT
GAGGACAGGTTGACTTTTAATAGACGGGGATCGTTGGTTGTGTCTGGGGGAGCCATGTTTGGCCGTGGTGATGCTGCTTATGGTGGTAGT
TTGGAAGCGATGTTGCGAGACAAAGATCATCCTCTTGGTCGTTTCCTCTCAACCTTGGGGCTCTCGGTTATGGACTGGCATGGAGATCTT
GCTATCGGATGCAATTCACAAACGCAGATACCTATTGGACGATACACAAACTTGATTGGCCGTGTCAACATTAACAATAAAGGGTCTGGA
CAAGTCAGTATCCGATTGAACAGCTCAGTAACAGCTTCAGATTGCTTTGATAAGCTTAATTCCACTTGTCAGAAAGCTGATXTAGCTACT
CTCAACCAGCACAATATGGATGATGATGAAACTAAGGTCAGCAGCGCACCATACAACCATTTGGTGACTTACAACTTCTATAXGTGGCCA
TTAGCTGATGGCATTACTGAACATGCAATTTATTTTCTTGXTGAAGCAAAGGAAGGACTTGGCCTGTCTGGCTTCGCTGGAAAAAGTGGT
TTTCCAGAATCATXX\
Edits in Original Sequence 
(5')XXCTTTCCTATTGTCATCCCTTCTACAGTCAAgGCCACAGGTTAAACTACCAGCAGAGCAATTTGATGATGATGATGAGGCTTTAG
ATGATGATCTGGATGAGTCTTCAGATTCGGAAGATGAATCAGAATATGATCAACTGCCACCTTTCAAGCGCTTGACCAAAGCACAGCTGG
CGAAGTTGTCCAAAGAGCAGAAGAAGGCCTACAATGATGAGTTAGAATACAGGGAAAAGCTCTTTATGAAAAAGCAGTTGAAGGAAGAGA
GGAAGAGGCGGAAGATGATGAAGAAAATGCAAGCTGCGGCTGAAAGTTTACCACCAACTGATCCCCGCGAAAATGTAGATGAAGAGACTG
GTGGTGCATCATCAGTGCCAGTACCCATGCCAGACTTGGCGTTACCTGCTTCATTTGATTCTGATAATCCAACTCATAGATATCGATATC
TGGATTCTTCAAATCAGTGGCTTGTGAGGCCTGTCCTAGAACCCAACGGTTGGGACCATGATGTTGGTTATGAGGGCATCAACGTAGAAA
GATTGTTTGTTGTCAAAGACAAGATCCCTATATCTTTGTCCAGTCAGGTTTCAAAGGACAAAAAGGACACCAATCTTCAAATGGAAATTG
CAAGTTCAGTAAAGCATGGGCATGGAAAAGCAACTTCTTTAGGTTTTGATATGCAGTCAGTTGGTAAAGACCTAGCTTATACTCTTCGCA
GTGAGACCAGATTCTGCAATTATAGGAAGAATAAGGCGACAGCTGGTCTTTCAGTAACTCTCTTAGGTGACGTCATGACAGGTGGTGTGA
AAATTGAGGACAGGTTGACTTTTAATAGACGGGGATCGTTGGTTGTGTCTGGGGGAGCCATGTTTGGCCGTGGTGATGCTGCTTATGGTG
GTAGTTTGGAAGCGATGTTGCGAGACAAAGATCATCCTCTTGGTCGTTTCCTCTCAACCTTGGGGCTCTCGGTTATGGACTGGCATGGAG
ATCTTGCTATCGGATGCAATTCACAAACGCAGATACCTATTGGACGATACACAAACTTGATTGGCCGTGTCAACATTAACAATAAAGGGT
CTGGACAAGTCAGTATCCGATTGAACAGCTCAGTAACAGCTTCAGATTGCTTTGATAAGCTTAATTCCACTTGTCAGAAAGCTGATXTAG
CTACTCTCAACCAGCACAATATGGATGATGATGAAACTAAGGTCAGaCAGCGCACCATACAACCATTTGGTGACTTACAACTTCTATAXG
TGGCCATTAGCTGATcGGCATTACTGAACATGCAATTTATTTTCTTGXTGAAGCAAAGGAAGGACTTGGCCTGTCTGGCTTCGCTaGGAA
AAAGTGGTTTTCCAGAATCATXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan