ESTScan Details for Unigene SGN-U271679

Score 
419
Direction 
Forward
Predicted Peptide Sequence 
EVMAIDCKFVPYLSCRPSKEIVFRFRATEKVTKFKLSPARFPFLISSSSSLWLRPTAISAAAYKKDVEESQDTFRLTYLEVYFLYIFIHP
EYYLVFIYXIVYLLFRGIAGCGKXGGIKILVDPILVGNLDFGIPWLYDAAKKVVKNFQIDDLPLIHCLLITQSLDDHCHLNTLKPLSRKF
PNLTVIATPNAKTLLDPLFTNVIYLEPGQDSEIEVSNGFQVKIEATAGPVLGPPWKRPENXVDLITHYRSFHS
Predicted Coding Sequence 
GAAGTGATGGCTATTGATTGCAAATTTGTTCCATACTTGAGCTGCAGACCTAGTAAAGAGATAGTGTTTCGATTCCGTGCAACTGAAAAG
GTTACCAAATTCAAGCTCTCACCTGCCAGGTTTCCTTTTTTAATATCTTCTTCATCTTCACTTTGGTTGCGGCCAACAGCCATCTCTGCT
GCCGCCTATAAGAAAGATGTGGAGGAGTCTCAGGATACCTTCAGATTAACTTACTTGGAGGTGTATTTTCTATATATCTTCATCCATCCC
GAGTATTATTTAGTATTTATTTATXTTATTGTTTATTTATTATTTAGGGGAATAGCTGGTTGTGGGAAGXTGGGAGGAATCAAAATTCTG
GTTGATCCAATCTTGGTGGGTAACTTGGATTTTGGAATTCCTTGGTTATATGATGCTGCCAAAAAAGTTGTCAAGAATTTTCAGATTGAT
GACCTTCCATTAATACACTGCTTACTCATTACACAAAGCCTTGATGATCATTGTCATCTCAACACATTAAAGCCTCTCTCCCGCAAGTTC
CCAAACCTCACTGTTATAGCTACTCCAAATGCTAAGACACTGCTCGATCCTCTTTTCACCAATGTCATCTACTTGGAACCTGGCCAGGAT
TCTGAGATTGAAGTGAGCAATGGCTTCCAGGTTAAAATTGAGGCTACTGCAGGGCCAGTTCTTGGACCTCCTTGGAAGCGACCTGAGAAT
GXGGTAGATTTGATTACACATTATCGTTCGTTCCACTCT\
Edits in Original Sequence 
(5')GAAGTGATGGCTATTGATTGCAAATTTGTTCCATACTTGAGCTGCAGACCTAGTAAAGAGATAGTGTTTCGATTCCGTGCAACTGA
AAAGGTTACCAAATTCAAGCTCTCACCTGCCAGGTTTCCTTTTTTAATATCTTCTTCATCTTCACTTTGGTTGCGGCCAACAGCCATCTC
TGCTGCCGCCTATAAGAAAGATGTGGAGGAGTCTCAGGATACCTTCAGATTAACTTACTTGGAGGTGTATTTTCTATATATCTTCATCCA
TCCCGAGTATTATTTAGTATTTATTTATXTTATTGTTTATTTATTATTTAGGGGAATAGCTGGTTGTGGGAAGXTGGGAGGAATCAAAAT
TCTGGTTGATCCAATCTTGGTGGGTAACTTGGATTTTGGAATTCCTTGGTTATATGATGCTGCCAAAAAAGTTGTCAAGAATTTTCAGAT
TGATGACCTTCCATTAATACACTGCTTACTCATTACACAAAGCCTTGATGATCATTGTCATCTCAACACATTAAAGCCTCTCTCCCGCAA
GTTCCCAAACCTCACTGTTATAGCTACTCCAAATGCTAAGACACTGCTCGATCCTCTTTTCACCAATGTCATCTACTTGGAACCTGGCCA
GGATTCTGAGATTGAAGTGAGCAATGGCTTCCAGGTTAAAATTGAGGCTACTGCAGGGCCAGTTCTTGGACCTCCTTGGAAGCGACCTGA
GAATGXGGTAGATTTGATTACACATTATCGTTCGTTCCACTCT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan