ESTScan Details for Unigene SGN-U271693

Score 
736
Direction 
Reverse
Predicted Peptide Sequence 
KKDTNHTGAFLEKDEFQAWAXPKIVTYKIDFTKSETEQIKFAVSHFRFPLPVHTXPVDQIGRVLRSMELKPGLSALVTGGASGIGKAXMF
GGYAEFVMVPSKHILPVAKPDPEVLAMLTSGLTASIALEKAAQMESGKVVLVTAAAGATGQFAVQLAKLAGNTVIATCGGYVKAKLLKDL
GVDRVIDYKVEDIKAVLKKEFPKGTDIVYESVGGEMFDICLNALAVYGRLVVIGMISQYQGEHGWKPRNYTGICEKLLAKSQTVAGFFLI
QYAHLWQEHLDRLVNLFSSGKLKIGIDPKQFVGLHSVADAVEYLHSGRSAGKVVVCIDPTYAQQPAKXISRQGKQLYPDPRRIQDAIITS
ESIW
Predicted Coding Sequence 
AAAAAAGATACAAATCACACGGGCGCTTTCCTCGAGAAAGATGAATTCCAGGCATGGGCAXATCCCAAGATAGTGACTTATAAAATCGAT
TTCACTAAATCTGAAACAGAACAAATTAAATTTGCCGTCTCACATTTTCGTTTTCCCTTACCTGTTCACACTAXACCAGTTGATCAAATC
GGTAGAGTGTTGAGAAGCATGGAGCTCAAGCCAGGCCTATCAGCGTTGGTCACCGGCGGTGCCTCCGGAATTGGTAAGGCAXCTATGTTT
GGCGGTTATGCTGAATTTGTCATGGTCCCTTCCAAACACATCCTTCCTGTAGCAAAACCAGATCCAGAAGTACTTGCAATGCTTACCTCT
GGACTCACCGCATCAATTGCTTTGGAAAAGGCTGCTCAAATGGAATCGGGAAAAGTTGTCCTCGTGACTGCTGCTGCAGGAGCAACAGGG
CAATTTGCAGTGCAGCTCGCAAAATTAGCTGGAAACACAGTAATTGCAACTTGTGGAGGTTATGTAAAGGCTAAGCTTCTTAAGGATTTG
GGAGTCGATCGAGTCATTGACTACAAAGTGGAAGATATAAAAGCTGTTTTAAAGAAGGAGTTCCCTAAAGGTACTGATATTGTCTACGAG
TCCGTTGGTGGTGAGATGTTTGACATTTGCTTGAATGCATTGGCTGTCTATGGACGACTTGTTGTCATTGGAATGATTTCTCAGTATCAA
GGAGAACATGGGTGGAAACCTCGGAATTACACTGGAATTTGTGAAAAGCTTCTAGCGAAAAGTCAAACGGTGGCTGGATTTTTCCTGATA
CAATATGCTCACCTATGGCAAGAGCATTTGGATAGACTGGTTAATCTTTTCTCTTCTGGAAAGCTTAAGATTGGTATAGATCCCAAACAA
TTTGTTGGCCTACATTCAGTTGCCGATGCTGTTGAGTACCTTCATTCTGGTAGAAGTGCTGGAAAGGTTGTCGTTTGCATTGACCCGACA
TACGCTCAACAACCTGCAAAAXCTATAAGTAGACAAGGAAAACAACTATATCCGGATCCAAGGAGAATTCAAGATGCAATAATCACTTCT
GAAAGTATATGG\
Edits in Original Sequence 
(5')AAAAAAGATACAAATCACACGGGCGCTTTCCTCGAGAAAGATGAATTCCAGGCATGGGCAXATCCCAtAGATAGTGACTTATAAAA
TCGATTTCACgTAAATCTGAAACAGAACAAATTAAATTTGCCGTCTCACATTTTCGTTTTCCCTTACCTGTTCACACTAXACCAGTTGAT
CAAATCGGTAGAGTGTTGAGAAGCATGGAGCTCAAGCCAGGCCTATCAGCGTTGGTCACCGGCGGTGCCTCCGGAATTGGTAAGGCAXCT
ATGTTTGGCGGTTATGCTGAATTTGTCATGGTCCCTTCCAAACACATCCTTCCTGTAGCAAAACCAGATCCAGAAGTACTTGCAATGCTT
ACCTCTGGACTCACCGCATCAATTGCTTTGGAAAAGGCTGCTCAAATGGAATCGGGAAAAGTTGTCCTCGTGACTGCTGCTGCAGGAGCA
ACAGGGCAATTTGCAGTGCAGCTCGCAAAATTAGCTGGAAACACAGTAATTGCAACTTGTGGAGGTTATGTAAAGGCTAAGCTTCTTAAG
GATTTGGGAGTCGATCGAGTCATTGACTACAAAGTGGAAGATATAAAAGCTGTTTTAAAGAAGGAGTTCCCTAAAGGTACTGATATTGTC
TACGAGTCCGTTGGTGGTGAGATGTTTGACATTTGCTTGAATGCATTGGCTGTCTATGGACGACTTGTTGTCATTGGAATGATTTCTCAG
TATCAAGGAGAACATGGGTGGAAACCTCGGAATTACACTGGAATTTGTGAAAAGCTTCTAGCGAAAAGTCAAACGGTGGCTGGATTTTTC
CTGATACAATATGCTCACCTATGGCAAGAGCATTTGGATAGACTGGTTAATCTTTTCTCTTCTGGAAAGCTTAAGATTGGTATAGATCCC
AAACAATTTGTTGGCCTACATTCAGTTGCCGATGCTGTTGAGTACCTTCATTCTGGTAGAAGTGCTGGAAAGGTTGTCGTTTGCATTGAC
CCGACATACGCTCAACAACCTGCAAAAXCTATAAGTAGACAAGGAAAACAACTATATCCGGATCCAAGGAGAATTCAAGATGCAATAATC
ACTTCTGAAAGTATATGG\(3')TAGCCTTGTTGTGCAAGGTACACTGTACAATGACAAATATGGAATTATATTCGTTTTGTAAAACAGT
TCTCAAACTTGTTATAAGGTGTCAAGTATTTATTTTCAACCTATTTGCGTAGAAGACTCAAAATTATAAAACAGACTTGCCCGCTTGAAA
AAAAAAAAAAAAAAAAAAAAAAC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan