ESTScan Details for Unigene SGN-U271694

Score 
1415
Direction 
Forward
Predicted Peptide Sequence 
KDTNHTGAFLEKDEFQAWAIPSIETYKSDFTKSETVQINSAVSHIGLPLPVHTXPVDQIGRVLRSMELKPGLSALVTGGASGIGKALCLA
LAKKGVFVTIVDFSEEKGKEVAGLAEKECAEFHSGLEFPVVMFIRCDVSNTGELKAAFEKHFVTYGGLDICVNSAGIGDIVPFHNDRTDG
SKSWRHVVNVNLVAVIDCTRLAIQAMQTDQKPGVIINLGSSSGLYPMYTGPIYSATKGGVVMFTRSLARFKHQGIRINVLCPEYVQTDLA
EKAVGSYVDRFGGYVPMELVVEGAFELIRDESKAGSCLWITNRRGLEYWPTPAEEAKYLLRSSKTRKKSLVTVPMDLQIPHSFEKVVVHT
LSHNFRSATRIVRTELRLPLKADHVLLKVIYAGVNASDVNFSSGRYFSGNGKDITSLLPLDSGFEAVGIIAAIGDAVRNLKIGMPAAIMT
FGGYAEFVMVPSKHILPVAKPDPEVLAMLTSGLTASIALEKAAQMESGKVVLVTAAAGATGQFAVQLAKLAGNTVIATCGGYVKAKLLKD
LGVDRVIDYKVEDIKAVLKKEFPKGTDIVYEPLGGEMFDIALNALAVYGRLVVIGMIS
Predicted Coding Sequence 
XXAAAAGATACAAATCACACAGGCGCTTTCCTCGAGAAAGATGAATTCCAGGCATGGGCAATCCCATCGATAGAGACTTATAAAAGCGAT
TTCACTAAATCTGAAACAGTGCAAATTAATTCTGCCGTCTCACATATCGGTCTTCCCTTACCTGTTCACACTAXACCAGTTGATCAAATC
GGTAGAGTGTTGAGAAGCATGGAGCTCAAGCCAGGCCTATCAGCGTTGGTCACCGGCGGTGCCTCCGGAATTGGTAAGGCACTATGTTTG
GCTCTTGCCAAGAAGGGAGTTTTTGTTACGATTGTTGATTTCTCAGAAGAGAAAGGCAAAGAAGTTGCAGGCCTTGCTGAGAAAGAGTGC
GCTGAGTTCCATTCTGGATTGGAATTTCCAGTTGTTATGTTCATCAGATGTGATGTCTCTAATACAGGAGAACTAAAAGCTGCTTTTGAG
AAGCATTTTGTAACATATGGAGGACTAGATATCTGTGTTAACAGTGCAGGCATCGGTGATATTGTTCCATTCCACAACGATCGAACTGAT
GGGTCTAAAAGCTGGAGACATGTAGTTAATGTGAACCTCGTCGCAGTTATAGATTGCACTCGTCTTGCGATTCAAGCCATGCAAACTGAC
CAAAAGCCAGGTGTAATAATAAATTTAGGCTCTTCTTCAGGACTCTATCCGATGTATACAGGCCCTATCTATTCTGCCACCAAAGGGGGT
GTTGTCATGTTTACGAGATCACTTGCTCGTTTTAAGCACCAAGGAATCCGCATCAATGTGCTCTGCCCTGAGTATGTCCAAACTGATTTG
GCAGAAAAGGCTGTTGGTTCATATGTTGATCGATTTGGAGGGTATGTTCCTATGGAACTTGTGGTGGAAGGTGCTTTTGAACTAATCAGA
GATGAGAGTAAAGCAGGGTCATGTCTTTGGATTACTAACAGAAGGGGTCTGGAGTATTGGCCAACTCCTGCTGAAGAAGCAAAATACCTC
CTCCGCTCTTCGAAAACACGCAAAAAATCTTTGGTCACAGTTCCAATGGATCTTCAGATTCCTCATAGTTTTGAAAAAGTAGTCGTTCAC
ACGTTGAGTCACAATTTCCGTAGTGCTACCAGAATTGTGCGAACAGAATTGAGGTTGCCTCTCAAGGCAGATCACGTTCTATTAAAAGTC
ATCTATGCTGGTGTTAATGCTAGTGATGTCAACTTCAGCTCAGGGCGGTATTTCAGTGGAAATGGCAAAGACATCACCTCCCTCCTTCCA
CTGGATTCTGGCTTCGAGGCTGTGGGAATAATTGCTGCAATTGGTGATGCTGTTAGAAATTTAAAGATTGGTATGCCTGCTGCCATAATG
ACTTTTGGCGGTTATGCTGAATTTGTCATGGTCCCTTCCAAACACATCCTTCCTGTAGCAAAACCAGATCCAGAAGTACTTGCAATGCTT
ACCTCTGGACTCACCGCATCAATTGCTTTGGAAAAGGCTGCTCAAATGGAATCGGGAAAAGTTGTCCTCGTGACTGCTGCTGCAGGAGCA
ACAGGGCAATTTGCAGTGCAGCTCGCAAAATTAGCTGGAAACACAGTAATTGCAACTTGTGGAGGTTATGTAAAGGCTAAGCTTCTTAAG
GATTTGGGAGTCGATCGAGTCATTGACTACAAAGTGGAAGATATAAAAGCTGTTTTAAAGAAGGAGTTCCCTAAAGGTACTGATATTGTC
TACGAGCCGTTGGGTGGTGAGATGTTTGACATTGCTTTGAATGCGTTGGCTGTCTATGGACGACTTGTTGTCATTGGAATGATTTCT\
Edits in Original Sequence 
(5')XXAAAAGATACAAATCACACAGGCGCTTTCCTCGAGAAAGATGAATTCCAGGCATGGGCAATCCCATCGATAGAGACTTATAAAAG
CGATTTCACgTAAATCTGAAACAGTGCAAATTAATTCTGCCGTCTCACATATCGGTCTTCCCTTACCTGTTCACACTAXACCAGTTGATC
AAATCGGTAGAGTGTTGAGAAGCATGGAGCTCAAGCCAGGCCTATCAGCGTTGGTCACCGGCGGTGCCTCCGGAATTGGTAAGGCACTAT
GTTTGGCTCTTGCCAAGAAGGGAGTTTTTGTTACGATTGTTGATTTCTCAGAAGAGAAAGGCAAAGAAGTTGCAGGCCTTGCTGAGAAAG
AGTGCGCTGAGTTCCATTCTGGATTGGAATTTCCAGTTGTTATGTTCATCAGATGTGATGTCTCTAATACAGGAGAACTAAAAGCTGCTT
TTGAGAAGCATTTTGTAACATATGGAGGACTAGATATCTGTGTTAACAGTGCAGGCATCGGTGATATTGTTCCATTCCACAACGATCGAA
CTGATGGGTCTAAAAGCTGGAGACATGTAGTTAATGTGAACCTCGTCGCAGTTATAGATTGCACTCGTCTTGCGATTCAAGCCATGCAAA
CTGACCAAAAGCCAGGTGTAATAATAAATTTAGGCTCTTCTTCAGGACTCTATCCGATGTATACAGGCCCTATCTATTCTGCCACCAAAG
GGGGTGTTGTCATGTTTACGAGATCACTTGCTCGTTTTAAGCACCAAGGAATCCGCATCAATGTGCTCTGCCCTGAGTATGTCCAAACTG
ATTTGGCAGAAAAGGCTGTTGGTTCATATGTTGATCGATTTGGAGGGTATGTTCCTATGGAACTTGTGGTGGAAGGTGCTTTTGAACTAA
TCAGAGATGAGAGTAAAGCAGGGTCATGTCTTTGGATTACTAACAGAAGGGGTCTGGAGTATTGGCCAACTCCTGCTGAAGAAGCAAAAT
ACCTCCTCCGCTCTTCGAAAACACGCAAAAAATCTTTGGTCACAGTTCCAATGGATCTTCAGATTCCTCATAGTTTTGAAAAAGTAGTCG
TTCACACGTTGAGTCACAATTTCCGTAGTGCTACCAGAATTGTGCGAACAGAATTGAGGTTGCCTCTCAAGGCAGATCACGTTCTATTAA
AAGTCATCTATGCTGGTGTTAATGCTAGTGATGTCAACTTCAGCTCAGGGCGGTATTTCAGTGGAAATGGCAAAGACATCACCTCCCTCC
TTCCACTGGATTCTGGCTTCGAGGCTGTGGGAATAATTGCTGCAATTGGTGATGCTGTTAGAAATTTAAAGATTGGTATGCCTGCTGCCA
TAATGACTTTTGGCGGTTATGCTGAATTTGTCATGGTCCCTTCCAAACACATCCTTCCTGTAGCAAAACCAGATCCAGAAGTACTTGCAA
TGCTTACCTCTGGACTCACCGCATCAATTGCTTTGGAAAAGGCTGCTCAAATGGAATCGGGAAAAGTTGTCCTCGTGACTGCTGCTGCAG
GAGCAACAGGGCAATTTGCAGTGCAGCTCGCAAAATTAGCTGGAAACACAGTAATTGCAACTTGTGGAGGTTATGTAAAGGCTAAGCTTC
TTAAGGATTTGGGAGTCGATCGAGTCATTGACTACAAAGTGGAAGATATAAAAGCTGTTTTAAAGAAGGAGTTCCCTAAAGGTACTGATA
TTGTCTACGAGtCCGTTGGGTGGTGAGATGTTTGACAtTTGCTTTGAATGCGTTGGCTGTCTATGGACGACTTGTTGTCATTGGAATGAT
TTCT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan