Notice: If you try to use Google Chrome to access the SGN FTP site, please check this link to resolve connection issues.

ESTScan Details for Unigene SGN-U271712

Score 
654
Direction 
Forward
Predicted Peptide Sequence 
MYRQKCIPNNFDLWRAFGGSSEIVSSDXVKMTKLHAFSDLLEHNNKDDCWLLISGKVYDVTSFLDDHPGGDEVLLTATGKDATDDFEDVG
HSDDAREMLKKYFIGEIDSSTIPAXTQTYPAFLNDTISWSTGFWKLMEDIAILVTFVDIGCSPRLPFLLPERIDQLSCFKMRLDTIEPSP
LQLVISYVVLPYSAYYVYLLPLLDVPYW
Predicted Coding Sequence 
ATGTATAGACAAAAGTGTATACCAAACAACTTTGACTTGTGGCGTGCGTTCGGCGGAAGTTCAGAGATTGTAAGCAGTGATXCTGTGAAG
ATGACCAAACTTCATGCTTTTAGTGACTTGTTGGAGCACAACAACAAAGATGATTGCTGGCTTCTCATCTCTGGAAAGGTTTATGATGTA
ACCTCATTTTTGGATGATCATCCTGGAGGAGATGAAGTCTTGCTAACTGCAACAGGTAAGGATGCAACAGATGATTTTGAAGATGTCGGT
CACAGTGATGATGCAAGAGAGATGTTGAAGAAATACTTCATTGGTGAAATTGACAGTTCCACCATTCCTGCAGXAACGCAAACATACCCT
GCCTTCCTCAACGACACCATCAGCTGGAGTACAGGGTTCTGGAAACTCATGGAAGATATTGCAATTCTTGTTACCTTTGTTGATATTGGT
TGCAGCCCTCGCCTTCCGTTCCTTTTACCAGAAAGAATAGATCAACTGTCATGTTTCAAGATGCGACTGGATACAATAGAACCTTCTCCT
CTGCAGCTTGTCATTTCATATGTTGTGCTTCCCTATTCAGCTTATTATGTGTATTTGCTACCTTTGTTGGATGTCCCTTACTGG\
Edits in Original Sequence 
CCAATTTGGTAGTAT(5')ATGTATAGACAAAAGTGTATACCAAACAACTTTGACTTGTGGCGTGCGTTCGGCGGAAGTTCAGAGATTGT
AAGCAGTGATXCTGTGAAGATGACCAAACTTCATGCTTTTAGTGACTTGTTGGAGCACAACAACAAAGATGATTGCTGGCTTCTCATCTC
TGGAAAGGTTTATGATGTAACCTCATTTTTGGATGATCATCCTGGAGGAGATGAAGTCTTGCTAACTGCAACAGGTAAGGATGCAACAGA
TGATTTTGAAGATGTCGGTCACAGTGATGATGCAAGAGAGATGTTGAAGAAATACTTCATTGGTGAAATTGACAGTTCCACCATTCCTGC
AGXAACGCAAACATACCCTGCCTTCCTCAACGACACCATCAGCTGGAGTACAGGGTTCTGGAAACTCATGGAAGATATTGCAATTCTTGT
TACCTTTGTTGATATTGGTTGCAGCCCTCGCCTTCCGTTCCTTTTACCAGAAAGAATAGATCAACTGTCATGTTTCAAGATGCGACTGGA
TACAATAGAACCTTCTCCTCTGCAGCTTGTCATTTCATATGTTGTGCTTCCCTATTCAGCTTATTATGTGTATTTGCTACCTTTGTTGGA
TGTCCCTTACTGG\(3')GATAATGAGATATTAAGATGTTGTTAGCTCTGTTGGTAATGTTTTCTGTTGGTGGATGTTAGAATAAAAGTT
CTATGGTAAAAAACAAATGGTGAAACAAGCCATATGGTTCTTCCATGATTGGCATCATTTGTTACGTAACAACTTTTACGTAATAGTTCA
CTCAGGTCACACTATATTACGTAAACATGGTGTGATATTGTCCGTTCAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan