ESTScan Details for Unigene SGN-U271724

Score 
573
Direction 
Forward
Predicted Peptide Sequence 
MTSASANENCLGWAARDPSGVLSPYEFNRRAVSSDDVLLDIAFCGMCFADVIWTRNIIGTSKYPLVPGHEITGIVREVGTDVKHFKVGDH
VGVGTYVNSCRECEYCCDELEVHCSEGAINTFDGIDVDGTVTKGGYSSYIVVNERYCFRIPENYPLASAAPLLCAGITVYTPMIRHNMNQ
PGKSLGVVGLGGLGHLAVKFGKAFGXKVTVFSTSISKREEALNLLGADKFVISSDEQQMMALSKSFDFIINSASGDIPFDTYLSLLKTAG
VLVLVGFPSEVKFIPGSLILGMKSIVGSVTGGTKQTQEMLDFCASHKIYPEIEIVPIQYVNEALERLIKKDVKYRFVIDERTASSKGGRK
SMFS
Predicted Coding Sequence 
ATGACTTCTGCAAGTGCAAATGAGAATTGCCTTGGTTGGGCAGCAAGAGATCCGTCTGGAGTTCTTTCACCTTATGAATTCAACCGGAGG
GCAGTCAGCAGTGATGATGTTCTGCTAGACATTGCATTTTGTGGGATGTGTTTCGCTGATGTTATCTGGACCAGGAATATAATTGGAACT
TCAAAATATCCTCTTGTGCCAGGACATGAAATTACGGGAATTGTGAGAGAGGTTGGTACGGATGTTAAGCACTTCAAAGTTGGCGACCAT
GTTGGAGTTGGAACATATGTTAATTCATGCAGGGAATGTGAATATTGTTGTGATGAATTAGAGGTTCATTGCTCAGAAGGAGCAATAAAC
ACTTTTGATGGTATAGACGTCGATGGTACAGTTACTAAAGGGGGATACTCCAGTTACATTGTAGTCAATGAAAGGTACTGCTTTAGAATA
CCTGAAAATTACCCGCTTGCATCTGCAGCACCTTTACTATGTGCTGGAATTACTGTTTATACTCCGATGATAAGACATAACATGAACCAA
CCGGGGAAATCTTTAGGTGTCGTTGGATTAGGTGGTCTAGGCCACTTAGCAGTGAAGTTTGGAAAGGCTTTTGGAXTTAAAGTAACGGTA
TTCAGTACAAGTATATCTAAGAGAGAAGAGGCGTTAAATCTTCTTGGAGCAGACAAGTTTGTAATCTCATCAGATGAACAGCAGATGATG
GCGCTGAGTAAGTCGTTTGACTTCATTATTAACTCCGCTTCTGGAGATATCCCATTTGATACATACTTGTCGTTGTTAAAGACTGCTGGC
GTTCTTGTTCTTGTTGGCTTCCCAAGTGAAGTGAAATTTATACCAGGAAGCTTAATCCTCGGTATGAAGAGCATCGTTGGGAGTGTAACG
GGTGGAACAAAGCAGACACAAGAAATGCTGGATTTCTGTGCTTCCCACAAAATTTATCCAGAAATTGAGATAGTCCCCATTCAGTATGTC
AATGAGGCACTCGAAAGGTTAATAAAGAAGGACGTCAAATATCGCTTTGTAATTGATGAGCGAACAGCATCAAGTAAAGGCGGGAGGAAG
AGTATGTTCTCTTGA\
Edits in Original Sequence 
GTTGGTTAGTTCTATCTCTTCCCTGTTCGTTCTTCCTTCCAGAATAATTGTA(5')ATGACTTCTGCAAGTGCAAATGAGAATTGCCTTG
GTTGGGCAGCAAGAGATCCGTCTGGAGTTCTTTCACCTTATGAATTCAACCGGAGGGCAGTCAGCAGTGATGATGTTCTGCTAGACATTG
CATTTTGTGGGATGTGTTTCGCTGATGTTATCTGGACCAGGAATATAATTGGAACTTCAAAATATCCTCTTGTGCCAGGACATGAAATTA
CGGGAATTGTGAGAGAGGTTGGTACGGATGTTAAGCACTTCAAAGTTGGCGACCATGTTGGAGTTGGAACATATGTTAATTCATGCAGGG
AATGTGAATATTGTTGTGATGAATTAGAGGTTCATTGCTCAGAAGGAGCAATAAACACTTTTGATGGTATAGACGTCGATGGTACAGTTA
CTAAAGGGGGATACTCCAGTTACATTGTAGTCAATGAAAGGTACTGCTTTAGAATACCTGAAAATTACCCGCTTGCATCTGCAGCACCTT
TACTATGTGCTGGAATTACTGTTTATACTCCGATGATAAGACATAACATGAACCAACCGGGGAAATCTTTAGGTGTCGTTGGATTAGGTG
GTCTAGGCCACTTAGCAGTGAAGTTTGGAAAGGCTTTTGGAXTTAAAGTAACGGTATTCAGTACAAGTATATCTAAGAGAGAAGAGGCGT
TAAATCTTCTTGGAGCAGACAAGTTTGTAATCTCATCAGATGAACAGCAGATGATGGCGCTGAGTAAGTCGTTTGACTTCATTATTAACT
CCGCTTCTGGAGATATCCCATTTGATACATACTTGTCGTTGTTAAAGACTGCTGGCGTTCTTGTTCTTGTTGGCTTCCCAAGTGAAGTGA
AATTTATACCAGGAAGCTTAATCCTCGGTATGAAGAGCATCGTTGGGAGTGTAACGGGTGGAACAAAGCAGACACAAGAAATGCTGGATT
TCTGTGCTTCCCACAAAATTTATCCAGAAATTGAGATAGTCCCCATTCAGTATGTCAATGAGGCACTCGAAAGGTTAATAAAGAAGGACG
TCAAATATCGCTTTGTAATTGATGtAGCGAACAGCATCAAGTAAAGGCGGGAGGAAGAGTATGTTCTCTTGA\(3')ACTGATTTAATTA
AACGTCGTAAAATCTCATATGAGCATTCATGTGGCTGTTGTAACACAGCTATAAAGAAGCCTATTCCCTTTCGTGCATCAGCGTTGTGTT
TTTTAAAAAGTAGTATTTTTTAAGGTCCAAGGTATAAGGGAATGATATTATGCAGGCTACACTAGATAGCCATGTTCATGCTCATATTTT
TGTTACTTTGGTCGTGCTTATCATGTGAGATTACACTGGGTATGTTGTTGTTGTTGACGACTTGACGTTGTTGGGTTGTTCCTATCATCT
TCTTTGTCTCTTTATATATTGCTATAATTCATTCCAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan