ESTScan Details for Unigene SGN-U271778

Score 
259
Direction 
Forward
Predicted Peptide Sequence 
MKQKVVIRLSLNGNNQKYRTKAFKIAVSQSGVESAAITGDGKNQLEVVGEVDXGDSNELIEEEFGSGGLGELGPAGGDKKPAAPAPAAAT
AAAAGGTVAAXARIIMPIRLXQYPVYQVTDSYGQSNCSIM
Predicted Coding Sequence 
ATGAAGCAAAAAGTTGTTATCAGACTATCTTTGAATGGAAACAATCAGAAATATCGAACCAAGGCCTTCAAGATTGCTGTTTCTCAATCA
GGTGTGGAATCAGCAGCTATAACAGGGGACGGAAAGAACCAACTAGAAGTTGTGGGAGAAGTAGACXGCGGCGACTCTAACGAGCTTATT
GAGGAAGAATTTGGGTCAGGCGGACTTGGTGAGCTTGGCCCGGCTGGTGGCGATAAAAAGCCCGCAGCTCCAGCTCCAGCTGCAGCTACA
GCTGCTGCTGCXGGTGGTACAGTCGCAGCCCXGGCTCGTATTATTATGCCTATCCGTCTTXATCAATACCCTGTTTACCAAGTTACAGAT
TCTTATGGTCAATCCAATTGTTCCATTATGTGA\
Edits in Original Sequence 
CCTCTCTTTCACACACTCTCTGCCTACTCAATTATACTTTAAAAATTCCCCATCAAACAAACAAA(5')ATGAAGCAAAAAGTTGTTATC
AGACTATCTTTGAATGGAAACAATCAGAAATATCGAACCAAGGCCTTCAAGATTGCTGTTTCTCAATCAGGTGTGGAATCAGCAGCTATA
ACAGGGGACGGAAAGAACCAACTAGAAGTTGTGGGAGAAGTAGACXGCGGCGACTCTAACGAGCTTATTGAGGAAGAATTTGGGTCAGGC
GGACTTGGTGAGCgTTGGCCCGGCTGGTGGCGATAAAAAGCCCGCAGCTCCAGCTCCAGCTGCAGCTACAGCTGCTGCTGCXGGTGGTAC
AGTCGCAGCCCXGGCTCGTATTATTATGCCTATCCGTCTTXATCAATACCCTGTTTACCAAGTTACAGATTCTTATGGTCAATCCAATTG
TTCCATTATGTGA\(3')AACAGAGGGATCCAAGATATAATAAACAATGTATTTACGGTCAAATATTTATTAATATGTTGATAGAAAAAA
AAAAAAACAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan