ESTScan Details for Unigene SGN-U271779

Score 
295
Direction 
Forward
Predicted Peptide Sequence 
MKQKVVIRLSLNGNDQKCRTKAFKIAVSQSGVESAAITGDGKNQLEVVGEVDAAILTNLLRKNLGQADLVSVGPAGGDKKPAAAAPAPAA
ATAAAAGGTVAAXARIIMPIRLXQYPVYQVTDSYGQSNCSIM
Predicted Coding Sequence 
ATGAAGCAAAAGGTTGTTATTAGACTATCTTTGAATGGAAACGATCAGAAATGTCGAACCAAGGCCTTCAAGATTGCTGTTTCTCAATCA
GGTGTGGAATCAGCAGCTATAACAGGGGACGGAAAGAATCAACTAGAAGTTGTGGGAGAAGTAGACGCAGCGATTCTAACGAACTTATTG
AGGAAGAATTTGGGTCAGGCTGACTTGGTGAGCGTTGGCCCGGCTGGTGGCGATAAAAAGCCCGCAGCTGCAGCTCCAGCTCCGGCTGCA
GCTACAGCTGCTGCTGCXGGTGGTACAGTCGCAGCCCXGGCTCGTATTATTATGCCTATCCGTCTTXATCAGTACCCTGTTTACCAAGTT
ACAGATTCTTATGGTCAATCCAATTGCTCCATTATGTGA\
Edits in Original Sequence 
GCATTTTAAATATTCCTCTCTTTCACACACTCTCTGCCTACTCAATTATACTTTAAAAATTCCCCATCAAACAAACAAA(5')ATGAAGC
AAAAGGTTGTTATTAGACTATCTTTGAATGGAAACGATCAGAAATGTCGAACCAAGGCCTTCAAGATTGCTGTTTCTCAATCAGGTGTGG
AATCAGCAGCTATAACAGGGGACGGAAAGAATCAACTAGAAGTTGTGGGAGAAGTAGACGCAGCGATTCTAACGAACTTATTGAGGAAGA
ATTTGGGTCAGGCTGACTTGGTGAGCGTTGGCCCGGCTGGTGGCGATAAAAAGCCCGCAGCTGCAGCTCCAGCTCCGGCTGCAGCTACAG
CTGCTGCTGCXGGTGGTACAGTCGCAGCCCXGGCTCGTATTATTATGCCTATCCGTCTTXATCAGTACCCTGTTTACCAAGTTACAGATT
CTTATGGTCAATCCAATTGCTCCATTATGTGA\(3')AACAGAGGGATCCAAGATATAATAAAAATGTATTTACGGTCAAATATTTATTA
ATATGTTGATAGATATTAGCGAGTTTGAGCAAAAGCTATTGGGTTCATGTGAACCTGAGCGATACAAAAAAATGATACTGGAAGGTCAAA
ACAGAGTATCATTTTAAGTTTTTTTTTGTTCGTTCAGAGAGCTTAATGGACTATCTAGTAGATGAAGAGTTTTGGTTTCCATCTTTGTAA
ATCCGTTTCAAGTAATAAAATATTTGAATTTTGTAGTGAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan